(data stored in ACNUC8465 zone)

EMBL: CP000828.PE85

CP000828.PE85        Location/Qualifiers
FT   CDS_pept        93723..95060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25176"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0C682"
FT                   /protein_id="ABW25176.1"
FT                   /translation="MVSNSKKDSGSQAIVLGGSIAGLLSARVLSEYFDQVIVIEADQLP
FT                   ISPFPRPGVAQSIHPHILFAKGYRILQKLYPTIEGELISKGGVKINWAADLHLFLNGKW
FT                   FTQAHEETEFTSFSCSRPLLEWAIRKLTFSISNIKLLEKHRATGLLADPSAGIVTGVEV
FT                   NDGQVTVPILGQLVIDASGHKSRLPQWLDKAGFQKPSETVIDPFLGYATRLYEQPKDFH
FT                   VDWQVLSISHTPPHNPRRGYIAFIENDQWLTTLGGFGGEFPPNDDQGYIDYAKTLASDK
FT                   FYQAIKLAKPASEIYLYRANSNRLRHYENTPLPQNLIALGDSVCSLCPVYGQGMTLSAE
FT                   ASLVLKGWLEQSRGKDLCSSKFQKKLAKSNTLAWMYATSQDSRFLSTKNRIAPSGLSKF
FT                   IAKYNERLLEKASEDPRLYTLFLEVIHQLKSPFAVINPWVAYQIFR"
     atggtcagca actcaaagaa agattcaggg agtcaggcga ttgttctagg tggaagcatt        60
     gctggtcttc tcagtgcgcg cgttttgtca gagtattttg atcaagttat tgttattgaa       120
     gctgatcaac tccctataag tccttttcct cgacccggcg ttgcgcagtc tatccatcct       180
     catattctgt ttgccaaagg ataccgaatc cttcaaaaac tttatcccac aattgaaggt       240
     gaattgattt ctaaaggtgg agtaaaaatt aattgggctg cagatttaca ccttttttta       300
     aatggaaagt ggtttactca agcccatgaa gaaactgagt ttacctcttt ttcttgtagt       360
     cgcccccttt tagagtgggc gattcgaaaa ttaacatttt cgattagtaa tatcaaacta       420
     ctggaaaagc atcgagccac tggactcctt gcagatccca gcgctggtat tgttactggt       480
     gtagaagtta atgatggtca ggttactgta cccattctgg gccagttggt gattgatgct       540
     agtggtcata aatccagact gcctcagtgg ttagataagg caggtttcca gaaaccctcc       600
     gagactgtta ttgatccttt tttaggctac gctacccgac tatatgagca acccaaggac       660
     tttcatgttg attggcaagt attgtcaatt tctcataccc cacctcacaa tccccgccga       720
     ggctacattg catttattga gaatgatcag tggctaacaa cacttggagg atttggaggt       780
     gaatttcctc caaatgatga tcaaggttat atagactatg caaaaacttt ggcgagtgac       840
     aaattctatc aggccatcaa gcttgctaag cctgcatctg agatttattt gtatagagca       900
     aattccaatc ggttaagaca ttatgagaac actcctcttc cccaaaattt gattgcatta       960
     ggcgattctg tctgttccct ctgtccagtc tatggccaag gtatgaccct tagcgcagaa      1020
     gcttcgttag tcttaaaagg ttggcttgag caatctcgag ggaaagattt gtgtagttct      1080
     aaatttcaaa aaaagcttgc aaagtctaac actctcgcct ggatgtatgc aacatctcaa      1140
     gattctcgtt ttctaagtac caaaaataga attgctccaa gtggacttag taagtttatt      1200
     gccaaataca acgaacgtct tcttgaaaag gcatctgaag atccacgttt gtatacattg      1260
     ttcctagaag ttatccacca gctgaaatca ccatttgctg ttatcaaccc ttgggttgca      1320
     tatcagattt tccgttga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page