(data stored in ACNUC5340 zone)

EMBL: CP000828.PE86

CP000828.PE86        Location/Qualifiers
FT   CDS_pept        95193..95660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0089"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein,
FT                   N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25177"
FT                   /db_xref="GOA:B0C683"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014419"
FT                   /db_xref="UniProtKB/TrEMBL:B0C683"
FT                   /protein_id="ABW25177.1"
FT                   /translation="MSTEATAVKKLIEQQSFGVLSTTSVAVEGFPFGSVTPYSLTESYH
FT                   PLIFISNLAQHTKNIINDNRVSLIILENLQDGSEDPQKHGRASILGRATPLETTGAENE
FT                   AKYQRYFQRFPESEGYQNTHGFQLYEITPVRIRFIGGFGKIFWLEPEQLTA"
     atgtctacag aagcaacagc agtcaagaaa ctcattgaac aacagagctt tggtgtcctg        60
     tctacaacat cagtagctgt ggaaggtttt ccctttgggt ctgtcacccc ctatagcttg       120
     acggaatcct atcatcctct aatttttatc agcaatttag cccaacacac taaaaacatc       180
     attaatgata atcgcgtctc tctaatcatc ctggaaaatt tgcaggatgg gtccgaggat       240
     ccacaaaagc atggacgtgc cagtattctg ggacgagcaa caccattaga aacaacgggc       300
     gctgagaacg aagcgaagta ccaacgctat tttcagcggt ttcctgagtc tgaaggatat       360
     cagaacaccc atggctttca gctctatgag attacgccgg tgcggattcg ctttattggt       420
     gggtttggaa agattttctg gttagagcct gagcaattga ccgcataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page