(data stored in ACNUC5340 zone)

EMBL: CP000828.PE91

CP000828.PE91        Location/Qualifiers
FT   CDS_pept        98833..98997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25182"
FT                   /db_xref="UniProtKB/TrEMBL:B0C688"
FT                   /protein_id="ABW25182.1"
FT                   /translation="MGARLRTLLNSSEEQTLFELRTATTVPQRVKDRAAMIRLSHQGMY
FT                   VEKIGLSGN"
     atgggtgccc gattacgtac tttattgaat agctcagaag aacagacctt atttgaactg        60
     aggacagcaa caacagtccc ccaacgggtc aaagatcgag ccgcaatgat tcgattgagt       120
     catcagggga tgtatgtaga gaaaattggg ctctccggga attag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page