(data stored in ACNUC27125 zone)

EMBL: CP000828.PE94

CP000828.PE94        Location/Qualifiers
FT   CDS_pept        100633..101184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25185"
FT                   /db_xref="GOA:B0C691"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0C691"
FT                   /protein_id="ABW25185.1"
FT                   /translation="MIWKRTRHSHRNKQDPVKKAIKLADLEMLQWAAASGEIELYYLDE
FT                   SGFCLWMPVEYSYFFKGEQKRMEQTKRRGRRISILGLLQPLTTFVYGLVVGSFNADRYI
FT                   KIMDEQACQAQQQLDKTGRIRVIVQDNGSSHTCNKAKQKWTQWQTQGLYLFFLPKYCSQ
FT                   MNPRNRVAPAQSAPIEGANV"
     gtgatctgga aacgaactcg tcatagtcac cgcaataagc aagaccccgt taagaaagct        60
     atcaaactcg ctgatttaga gatgttgcag tgggcagcag cgagtggaga gattgagttg       120
     tattacctgg atgagtctgg tttttgccta tggatgcccg tggaatatag ctatttcttc       180
     aagggagagc aaaagcggat ggaacagact aaacgtaggg gaagacgtat cagtattttg       240
     gggcttctcc aaccgttgac gacctttgtt tatgggctag ttgtcggcag ttttaatgcc       300
     gaccgttaca tcaaaataat ggatgaacaa gcatgccagg cccaacaaca actggataaa       360
     actggacgaa ttcgggtcat cgttcaagac aatggctcta gtcatacttg caacaaagcg       420
     aagcaaaaat ggacacagtg gcaaacccaa gggctctatt tgttctttct gcccaaatac       480
     tgttcacaga tgaatccgag aaacagagtg gcaccagctc aaagcgcacc aattgagggg       540
     gcaaatgttt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page