(data stored in ACNUC27125 zone)

EMBL: CP000828.PILC

CP000828.PILC        Location/Qualifiers
FT   CDS_pept        complement(390490..391710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="AM1_0417"
FT                   /product="type II secretion system domain protein/ pilin
FT                   biogenesis protein PilC"
FT                   /note="Member of bacterial type II secretion system protein
FT                   F domain, PF00482."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25474"
FT                   /db_xref="GOA:B0CAY4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY4"
FT                   /protein_id="ABW25474.1"
FT                   /translation="MPTYVVRARDSQGKSSQKRVNATSQKEARSNIQRQGLQILDIKES
FT                   QGFSMNAELDLSFLQSITVKDKALFSRQFSALVNAGVALVRGLGVMSEQCKNPKLKKAL
FT                   LDVNAAVQQGVSLSDAMRGHPAAFDQLYVAMIQAGETGGVLDEVLNRLATLLEDQARLK
FT                   NQIRSALAYPVVVGFIAVSIFLGMVIFLIPVFDGIFSQLGGDLPAFTQFMVNLSEFLRT
FT                   PIYGISAAIVVFGSTFALRQYYRTRAGRETIDRIMLKLPLFGDLIQKTAVARFCRTFGS
FT                   LSRSGVPILYSLEIVRDTAGNQVVSNAIDEARREIQGGGMLSLALQKEKVFPLLATQMI
FT                   NVGEETGEIDKMLMKVADFYEDEVEQAVKAMTSVMEPLMIVVLGGMVGSILVAMYLPMF
FT                   KIFDLIG"
     atgccaactt acgtcgtccg tgcgcgagac tctcaaggaa aatcaagcca aaaaagggta        60
     aacgcaacct ctcaaaaaga agctcgttct aatatccaac gccaagggct acagatcctt       120
     gatataaagg aatctcaagg cttcagcatg aatgctgagc tggatctgag ttttcttcag       180
     tccatcactg ttaaagataa agctttgttc tcgagacagt tttcagctct agtcaatgcc       240
     ggggttgcat tggtaagggg cttgggagtt atgtctgaac agtgtaagaa tcctaagctt       300
     aaaaaggcac ttctagatgt caatgctgct gtccaacaag gcgttagctt atcagatgct       360
     atgaggggcc accctgctgc tttcgatcag ctgtatgttg ccatgattca agcaggtgaa       420
     acaggtggtg ttttggatga ggttctcaat cgtctagcca ctttgctgga agatcaagcg       480
     cgtttgaaaa accagattcg atcagcgcta gcatatccag ttgtcgttgg ttttatcgct       540
     gtttcaatct ttttgggaat ggttattttc cttatcccag tatttgacgg catatttagc       600
     caattaggtg gtgacttacc tgcatttact caatttatgg tgaatctcag tgaatttctg       660
     agaacaccga tttatgggat ttcagctgcc attgtagttt ttggatccac atttgccctt       720
     cggcagtact atcgaacccg agcaggcaga gaaactattg atcgaatcat gcttaagttg       780
     cctctgtttg gtgatctgat tcaaaagacg gctgtggcta gattttgtcg aacttttggg       840
     tcactttctc gttcgggtgt gcctattctc tattctctcg aaattgttcg tgatactgca       900
     ggaaaccagg ttgtatctaa cgctattgat gaagctcgac gagaaattca agggggtggc       960
     atgttgagct tagcgttgca aaaagaaaaa gtatttcctc tcctagcgac tcaaatgatc      1020
     aatgttgggg aagaaacagg agagattgac aagatgctga tgaaggttgc tgatttttat      1080
     gaagatgaag tcgaacaggc ggttaaagcc atgactagtg tgatggaacc cttgatgatc      1140
     gttgttttag gaggtatggt tggttccatt cttgtggcta tgtatttgcc tatgttcaag      1200
     atcttcgatc taatcggtta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page