(data stored in ACNUC8465 zone)

EMBL: CP000828.PLSX

CP000828.PLSX        Location/Qualifiers
FT   CDS_pept        639059..640093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="AM1_0652"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25700"
FT                   /db_xref="GOA:B0CE66"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CE66"
FT                   /protein_id="ABW25700.1"
FT                   /translation="MGATRARIAIDAMGGDHAPDEIVAGALRAQAELDADVLLVGDPDR
FT                   LEASIKSHSDSVPVEIIPSEGLIEMNEEPISALRRKRKASINVAMDLVKKKKADAVVSA
FT                   GHSGAAMAAALLRLGRIPGIDRPAIGGVFPTIIAGKPVLVLDVGANVDCRPAFLDQFAT
FT                   MGTIYSEYVLGTEAPKVGLLNIGEESCKGNEVSVQTYQLLEQNPHVDFIGNAEGRDVLS
FT                   GQFDVIVCDGFTGNILLKFAEAVGEVALQILREELPRGIHGKVGTGILKPNLRRIKQRM
FT                   DHAEHGGGLLLGVAGVCIISHGSSQAPSIFNAIRLAKEAADNQVSQRIQSCYQQTVTAA
FT                   SNGE"
     atgggagcca ctcgcgcacg tattgccatt gacgccatgg ggggcgacca tgccccagat        60
     gagattgttg ctggtgcctt aagagcccaa gcagaattgg atgcagatgt cttactagtc       120
     ggtgatcctg accgtcttga agcttccatc aaaagccatt ctgattccgt ccccgttgaa       180
     atcatccctt ctgaagggct gatcgagatg aacgaagagc cgatcagcgc ccttcgccgc       240
     aagcgtaagg cctcgatcaa tgtggcgatg gatttagtca aaaagaagaa ggctgatgca       300
     gttgtttcag caggtcactc tggagctgca atggctgccg ccctcctgcg attgggtcga       360
     attccaggga ttgatcgacc ggccattggc ggtgtcttcc ccaccatcat tgctgggaag       420
     cctgtgttag tgctggatgt tggggcaaat gtagactgtc gcccggcatt tctcgatcaa       480
     tttgccacca tgggcaccat ctacagcgag tacgttttag ggactgaagc gccaaaagtg       540
     ggattgctca acattggaga agaatcctgt aagggcaatg aagtatcggt tcaaacctat       600
     caattattag agcagaaccc tcacgttgac tttattggta atgctgaggg acgagatgtg       660
     ctctctggtc agtttgatgt cattgtttgc gatgggttta ccggaaatat ccttctgaaa       720
     tttgcagagg cggtgggcga agttgccctt caaatactac gagaagagct gcctagaggc       780
     atccacggca aagtggggac aggtatttta aagcccaact tgcgtcggat taaacagcgg       840
     atggaccatg cagagcatgg tggaggattg ctcttaggcg ttgcgggtgt ctgtattatc       900
     agtcatggca gttcccaagc accttcaatc tttaatgcca ttcggttggc aaaagaagct       960
     gcggataatc aggtatccca gcgaattcag tcttgctatc aacagacggt gacagccgcc      1020
     tccaatggag aataa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page