(data stored in ACNUC5340 zone)

EMBL: CP000828.PSBO

CP000828.PSBO        Location/Qualifiers
FT   CDS_pept        complement(502849..503652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="AM1_0526"
FT                   /product="photosystem II manganese-stabilizing protein
FT                   PsbO"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25578"
FT                   /db_xref="GOA:B0CC36"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC36"
FT                   /protein_id="ABW25578.1"
FT                   /translation="MRFRTLIVTFLAVCLGVFSVNAKALAVVPSSMTYDQVKGTGLADS
FT                   CPTLPTGTGDTISVGGSAYITDLCFQPTSFFVKEEPKNPRQEAEFVPASVMTRKTTTLE
FT                   QIEGPLSADGGGLTFKEKDGMDFQAITVQISGRERVPMLFTVKELLASASGSSIADGTS
FT                   FSGEYAVPSYRTSGFLDPKGRGVSTGYDNAVALPASADADKLNRANAKRFDLTKGSISM
FT                   DVASVDSETGEFGGTFESEQFSDSDLGAIDPLEVKVRGIFYGRVN"
     atgagatttc gcactttaat cgttactttt ttagcggtct gtctgggggt tttctcagtc        60
     aacgccaaag ctttggcagt tgtacccagc tctatgacct acgaccaggt aaaaggcact       120
     ggtctggctg atagctgccc aacccttcct acaggcaccg gtgacaccat atcagtcgga       180
     ggctctgcct acattacaga tttgtgtttc caacccactt ctttcttcgt gaaagaagag       240
     cctaagaacc ctcgccaaga ggccgaattc gtgcctgcga gcgttatgac tcggaaaaca       300
     acgacccttg agcagattga aggaccttta tctgctgatg gcggcggttt aacgttcaaa       360
     gaaaaagacg gtatggattt ccaagctatt accgtacaaa tttctggccg tgaacgggta       420
     cccatgctgt tcaccgtcaa ggagcttcta gcttctgcct ccggtagctc catcgctgac       480
     ggaactagct tctctggaga gtatgctgtt ccttcatacc gaacttcagg tttcttagat       540
     cccaaaggtc ggggtgtttc cacaggttat gacaatgctg tcgcactacc tgcttctgca       600
     gatgctgaca agctaaaccg agccaatgcc aagcgctttg acctcaccaa aggtagtatc       660
     tccatggatg ttgcttctgt tgatagcgaa actggagaat ttggtggcac cttcgaaagc       720
     gaacagtttt cagatagtga cttaggtgct attgacccct tagaagtgaa agtccgtgga       780
     attttctatg gtcgtgtcaa ctaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page