(data stored in ACNUC5340 zone)

EMBL: CP000828.PSBP

CP000828.PSBP        Location/Qualifiers
FT   CDS_pept        603103..603642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbP"
FT                   /locus_tag="AM1_0613"
FT                   /product="photosystem II oxygen evolution complex protein
FT                   PsbP"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25663"
FT                   /db_xref="GOA:B0CD72"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD72"
FT                   /protein_id="ABW25663.1"
FT                   /translation="MFKRIAALALIILSLTLQACASDTAGLQAYADNIDGYTFMYPNGW
FT                   APIKVPGSSDVVFHDLIEETENVSVVVSDITSDTQLTDLGDPTEVARTLLNAVIAPSQS
FT                   GQEADLLAAASRTEDDKVYYALEYSVDLPIGKRHNLSTVVVRRGKLFTLSLSTPESRWT
FT                   KVEPVFQRVVDSFSVY"
     atgttcaaaa gaatcgcagc acttgcactc attatattaa gtctgacctt acaagcctgc        60
     gcgtctgata cagccggatt gcaagcttat gcagacaata ttgatgggta tacctttatg       120
     tatcccaatg gttgggcacc catcaaagta cccggtagct ctgacgttgt gtttcatgac       180
     ctgatcgaag agaccgaaaa tgtgagcgta gtcgtgagtg acatcactag cgacactcag       240
     ttgacggatt taggagatcc cactgaagtg gcccgcaccc ttttgaatgc agtgattgca       300
     ccttcccaat ctggccagga agcggattta ttggctgcag cttcgcgaac agaagatgat       360
     aaggtctact acgcccttga atattcggtt gatttaccca ttggtaagcg ccataacctt       420
     tcgaccgtag ttgttcgtcg gggtaagttg tttaccctta gcctctccac accagagtct       480
     cgttggacca aggttgagcc tgtgttccag cgcgttgtgg attctttctc tgtttactaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page