(data stored in ACNUC5340 zone)

EMBL: CP000828.PSTA

CP000828.PSTA        Location/Qualifiers
FT   CDS_pept        complement(179281..180216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="AM1_0175"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25261"
FT                   /db_xref="GOA:B0C7K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K1"
FT                   /protein_id="ABW25261.1"
FT                   /translation="MTLSNPKDLPGLEDSENSQFKPALDTRYRWDRFFEALTWLATIIS
FT                   LVVLATLLFDVLSDGASSLSVDFLTSPPSRKAAKAGLWPALMGTVWLLCITAAVAFPIG
FT                   VGSGIFLEEFAPDNLFTRIIEINVGNLAAVPSIVYGLLGLTVFVDIMRPITGGSSVLAG
FT                   GLTLALLILPIIIVSTREALRAVPSSLRQGGFALGATRWQVIRDLVFPQSLPGILTGTI
FT                   LALSRAIGETAPILVVGAAGYIAFAPPLSLEGLQSDFTALPIQIYVWIARAQKSFEPIA
FT                   AGGIIILLVVLLLMNTTAILLRNKFQNQKL"
     atgactttat caaatcccaa ggatttaccc ggtctggaag acagtgaaaa ttcacaattt        60
     aagcctgccc ttgataccag atatcgatgg gatcgtttct ttgaggccct gacgtggctg       120
     gccaccatta ttagtttggt ggtattggcg acattgctat tcgatgtgct ctctgacggt       180
     gctagcagtc tgagtgttga ctttttaacc agtccccctt cccgtaaagc tgcaaaagct       240
     gggctttggc cagcgctgat gggtactgtt tggctcctct gcattactgc agcagttgct       300
     tttcctatcg gtgtgggttc tggcatcttt ctagaagagt ttgcccccga taaccttttt       360
     actcggatta tcgaaattaa tgttggaaat ttggcagcag tcccatctat tgtctatggt       420
     ctgttgggac taacggtttt tgtggacatt atgcgtccaa ttacgggtgg cagcagtgtc       480
     ctagctggag gcttaacgtt agctttatta attttgccca ttattattgt cagtacccgt       540
     gaggctctgc gagcggtccc tagtagtttg cgccagggag gatttgccct aggggcaacg       600
     cgctggcaag ttattcggga cctggttttt ccccaatctc ttcccggtat tttgacggga       660
     accattctgg ccctgtctcg tgccattggc gaaacagctc ctattttagt agtgggtgct       720
     gcgggatata tcgcttttgc ccccccttta tctcttgaag ggctgcaatc agactttact       780
     gcactgccta tccaaattta tgtctggatt gcccgagctc agaaatcatt tgagccgatt       840
     gcagctggag gcatcattat tttgttagtg gtcctgttgc ttatgaatac aaccgctatt       900
     ctgcttcgta ataaattcca gaatcaaaag ttgtaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page