(data stored in ACNUC5340 zone)

EMBL: CP000828.RSGA

CP000828.RSGA        Location/Qualifiers
FT   CDS_pept        399963..401048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="AM1_0425"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25482"
FT                   /db_xref="GOA:B0CAZ2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ2"
FT                   /protein_id="ABW25482.1"
FT                   /translation="MSKQAQAATDTPLTGTVLAVQANFYQVQLQAAQNFPSSQLLCTRR
FT                   SRLKKLRQQVMVGDQVVVEEPDWLGQRGAIASILPRQSQLARPPIANVNQILLMFALAE
FT                   PKLDPQQLTRFLVTAEQTHLPIILCFNKRDLTTYATQKAWRDRMKRWGYDPILISLQTG
FT                   VGLKALERPLREHITVASGLSGVGKSSLINHFIPDIDLRVGRVSERWGQGRHTTRHVEL
FT                   FELSKGGFLADTPGFNQPSLSNILPAQLGQCFPEIRQRLSQARCQFKDCQHMDEPNCAV
FT                   RGDWERYPYYLNLLAEVTEEHAKRQMTATTEARTKRKSGKRGKIKNEPKLETKRYRRPS
FT                   RRQLQQDLQNIDLDHLEHSSP"
     atgagtaagc aagcacaagc agcaactgat actcctttaa cgggaacggt gttagctgtt        60
     caggccaatt tttatcaggt acagcttcag gccgcacaga attttccttc tagtcagctg       120
     ctctgcactc gtcgctctcg cctcaaaaag ctgaggcagc aggtcatggt aggggatcaa       180
     gtggttgtag aagaaccgga ttggttaggg caacgaggtg cgatcgcaag tatcctcccc       240
     cgtcagtccc aactcgctcg tccgcccatt gccaatgtca atcaaatcct attgatgttt       300
     gccttggcgg agcccaaatt agaccctcag caattgaccc gctttttagt cacagcagaa       360
     cagacccacc tccccattat tctttgtttc aataagcggg atttaaccac ttacgcgacg       420
     caaaaagcct ggcgcgatcg catgaagcgg tggggctatg atcccattct gatcagtctc       480
     caaacggggg tagggttaaa ggcccttgag cgccccctta gggaacacat caccgtagca       540
     tcagggctat caggggtagg caaatccagt ctgatcaacc atttcatccc agacattgac       600
     ctgcgagtgg ggcgtgtctc ggagcgatgg ggccagggtc gtcataccac ccgtcatgtc       660
     gagctatttg agctctctaa ggggggcttt ttagcggata cccctggttt taaccagccc       720
     agcctaagca atattctgcc agctcagtta ggccagtgtt tccccgaaat ccgacagcgg       780
     ctctcccagg cccgttgtca atttaaggat tgccaacata tggatgaacc caactgtgcc       840
     gttcgaggtg actgggagcg ttatccatat tatttgaact tgttggcaga ggtgacagaa       900
     gaacatgcca agcgacaaat gacagccaca actgaagctc ggacgaagcg taagtccggc       960
     aagcggggca aaatcaaaaa tgagcccaag ttagaaacga agcggtatcg tcgcccctcc      1020
     cgacgccagc tccagcaaga tctccaaaat atcgatttag atcacctaga acattcatca      1080
     ccttga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page