(data stored in ACNUC8465 zone)

EMBL: CP000828.SPHX

CP000828.SPHX        Location/Qualifiers
FT   CDS_pept        complement(168971..169963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sphX"
FT                   /locus_tag="AM1_0168"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25254"
FT                   /db_xref="GOA:B0C7J4"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J4"
FT                   /protein_id="ABW25254.1"
FT                   /translation="MQLNRSTLTGAVVSLAVAVSTTAFSATSADAQTKKIKIDGSSTVF
FT                   PISEAVAEEFQKLTNNKVNVTVGVSGTGGGFKKFCAGETDISDASRPIKEKEQKLCEGV
FT                   EYIEIPVAFDALTVVVNKGNPIKSMTVAELKKMWSENPEGSVTTWKEVNSSWPADKISF
FT                   YAPGSDSGTFDYFNGTIAKKNHRKDITASEDDNILVQGVSREPNGIGYFGFAYYEQNKD
FT                   RLNAVAIDNGNGPVLPSREAVENGTYTPLSRPIFIYVNKKAAKRPEVRQFVNYYLRKAA
FT                   EFSAEVGYIPLPAPAYQQAAKNFREGKTGSFFAGRDTDGLKVSEVLKSK"
     atgcagctga atcgttcgac cctgacaggt gcggttgttt cgctagcggt cgccgtcagc        60
     acaactgctt tctcggccac ttctgccgat gcccaaacta aaaagataaa aattgacggt       120
     tccagtaccg tatttccaat cagtgaagcc gttgctgagg aatttcaaaa gttaacaaat       180
     aacaaggtta acgtcacagt cggtgtgtct ggaaccggtg gcggttttaa gaagttttgt       240
     gcaggtgaaa cagatatttc tgacgcatct cgacccatta aagagaaaga acaaaagctt       300
     tgtgaagggg ttgagtatat cgaaatccct gttgcttttg atgctttaac cgttgtggtc       360
     aacaaaggca atcccatcaa gagtatgacc gttgctgaac tcaagaagat gtggtcagaa       420
     aacccagagg gttctgttac tacatggaaa gaagtcaatt ccagctggcc cgctgataaa       480
     atcagctttt atgccccagg ttctgattcg ggtacttttg actacttcaa tggcaccatt       540
     gccaagaaaa atcatcgcaa agatataacc gccagcgaag atgacaatat tttggttcaa       600
     ggcgtttccc gtgagcccaa tggaattgga tattttggat ttgcctacta tgagcaaaat       660
     aaagatcgcc tgaatgcagt ggcgattgac aatggtaatg gacccgtcct cccctcccgt       720
     gaagcagtgg agaatggcac ctacacgcct ctgtctcgcc ctatctttat ttatgtcaat       780
     aagaaggccg ccaagcgtcc tgaagttcgc cagtttgtga actactacct cagaaaagct       840
     gctgagtttt ctgctgaagt cggctatatc cctttacctg ctccggctta tcagcaagcg       900
     gctaaaaatt tccgcgaagg caagactggc agcttctttg cgggtagaga tacagatggc       960
     ctaaaggtct ctgaagtgct caaatccaaa tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page