(data stored in ACNUC27125 zone)

EMBL: CP000828.SPPA

CP000828.SPPA        Location/Qualifiers
FT   CDS_pept        complement(9275..10096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="AM1_0011"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25100"
FT                   /db_xref="GOA:B0C4Y8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Y8"
FT                   /protein_id="ABW25100.1"
FT                   /translation="MIWPFKGARKQIARLEIKGAIAGATRKHVLEALKTIEEKGYPVLL
FT                   LRIDSPGGTVVDSHEIYSALIKLREKIKIVASFGNISASGGVYIGMGAEHIMANPGTIT
FT                   GSIGVILRGNNLERLLDKVGVSFKVIKSGPYKDILAFDRELTEPERQILQDLIDSSYSQ
FT                   FVEIVAEGRNLEVDAVKQFADGRVFTGQQALELGLVDRLGTEEDARCWAAELAGLDPEK
FT                   AKCNTIEEHKSFWSKLLPGSRQSSWSVPPQVADWVNFEIATNGLPLWLYRP"
     atgatttggc cgtttaaagg tgcccgcaaa caaatagccc gtttggagat caaaggtgcg        60
     atcgcaggcg caacccgaaa gcatgtcttg gaagccctca aaacgattga agagaaaggc       120
     tatccagtgc ttctcctccg tatcgatagt ccaggaggaa cggtcgttga ctcccatgaa       180
     atttacagtg ctctgatcaa attgcgagaa aaaatcaaga ttgttgccag ctttggcaat       240
     atttcggctt ctggtggggt ctatattggc atgggggctg aacatatcat ggctaaccca       300
     ggtaccatca ccggcagtat tggcgtgatc cttcgaggga ataatctgga acgtctatta       360
     gataaggtgg gggtttcctt taaggtcatc aagtctggtc cctacaaaga cattctcgcc       420
     tttgatcgag agttaactga accggagcgt caaatcctcc aagatctgat tgacagcagc       480
     tattctcagt ttgtggagat tgtggcagaa ggtcgaaacc tagaagtaga cgccgttaag       540
     caatttgctg atgggcgtgt cttcacggga caacaagcgc ttgaacttgg cctagtggat       600
     cgattaggaa cagaagaaga tgcccggtgc tgggcggctg aactagcagg cctagatcct       660
     gagaaggcca aatgcaacac aatagaagaa cataaatcct tttggagtaa gctgctaccc       720
     ggtagccgcc aatcttcctg gtctgtacct ccccaagttg cggattgggt gaattttgag       780
     atagcaacga atggcttacc cttgtggctc tatcgacctt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page