(data stored in ACNUC27125 zone)

EMBL: CP000828.THIF

CP000828.THIF        Location/Qualifiers
FT   CDS_pept        304808..305443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="AM1_0333"
FT                   /product="ThiF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25392"
FT                   /db_xref="GOA:B0C9V2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V2"
FT                   /protein_id="ABW25392.1"
FT                   /translation="MTEQFFHEQLYRSTQQMAMLRDYPVTVCGAGALGANLVETLARSG
FT                   YGKLKVIDCDRIETRNLSTQPYYRSDVGAYKGKILANMLYRALGTTVDVIPKQLTAANT
FT                   QSLLRGSSLVIDTFDNSVSRQAVKDYCLEQDIPCLHAGLAAEYAEVVWEPEYQVPSATH
FT                   DDICDYPLARNLVLLTVAIASETITRFITEGRQQSCTITLRDFVIHTS"
     atgactgaac aattttttca tgagcagcta tatcgatcta cccaacagat ggcgatgctc        60
     cgagattatc cggtgaccgt atgtggcgca ggtgcactag gggccaactt agtggaaacc       120
     ctggcccgct ccggctacgg aaaacttaaa gtgattgact gcgatcgcat cgagactcgc       180
     aacctttcta cccagcccta ctatcgatct gatgtcgggg cctataaagg caagatccta       240
     gccaatatgc tgtatcgagc tctgggaact acggtggacg tgattcccaa gcagctcacc       300
     gccgccaata cccagtcact attacggggg agttctttgg ttattgatac cttcgataac       360
     agtgtttctc gccaagcggt taaagactat tgtttagagc aggatattcc ttgcctccat       420
     gctggattgg ctgcggagta tgcagaagtg gtttgggagc cggagtatca agtgccatcg       480
     gcaacccatg atgatatctg cgactatccc ctagcgcgga atttggtgtt gttgaccgtt       540
     gcgatcgcaa gtgaaaccat cactcgattc atcacggaag gtcgtcaaca aagctgtacg       600
     attacccttc gagactttgt gattcacacc agttga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page