(data stored in ACNUC5340 zone)

EMBL: CP000828.TYPA

CP000828.TYPA        Location/Qualifiers
FT   CDS_pept        complement(63308..65101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="AM1_0067"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25155"
FT                   /db_xref="GOA:B0C543"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B0C543"
FT                   /protein_id="ABW25155.1"
FT                   /translation="MTLLPIRNVAIIAHVDHGKTTLVDALLKQAGTFREGEDVPDCVMD
FT                   SNDLERERGITILSKNTAVTYKETLINIVDTPGHADFGGEVERVLGMVDGCLLIVDANE
FT                   GPMPQTRFVLKKALEKGLRPIVLVNKIDRPQADPHGAVDKVLDLFIELGADDDQCDFPY
FT                   LFASGLDGYAKEDLDAPGEDMKPLFESFLHHVPPPVGDPEKPLQLQVTTLDYSDYLGRI
FT                   VIGKIHNGTINMGQQAALINEHGEMVKAKVSKLMGFEGLQRVELATASAGNLVAIAGFA
FT                   NANIGETITCPNEPQALPLIKVDEPTLQMTFCVNDSPFAGQEGDFVTSRQIRDRLMREL
FT                   ETNVALRVEETDSPDRFAVSGRGELHLGILIETMRREGYEFQVSQPQVIYREVNGQPCE
FT                   PYEYLVLDVPEEAVGGCIERLGQRRGEMQDMQVSNGRTQLEFVIPARGLIGFRGEFMRL
FT                   TRGDGIMNHSFLEYREMAGDISSRRNGVIIAFEEGTATFYALKNAEDRGSFFIEPGVKV
FT                   YKGMIVGEHNRPQNLDLNVCKTKHLTNHRSSTGDELVQLQAPVDMSLERALEYIGPDEL
FT                   VEVTPESVRLRKLEKKKLAKR"
     atgacgctcc ttccgattcg taacgtcgcc attattgccc acgttgatca cggcaaaacg        60
     accctcgttg atgccctact gaagcaagcc ggcaccttcc gtgaaggaga ggatgttccc       120
     gattgcgtca tggactctaa cgatttagag cgggaacggg gtattaccat tttgtccaag       180
     aatacggcgg ttacctacaa agagaccctg attaatattg ttgatacccc aggacacgct       240
     gactttggcg gggaagtgga acgggtgtta ggcatggtgg atggctgtct gctgattgtg       300
     gatgccaacg aaggccctat gccccaaacg cggtttgtat tgaaaaaagc cttggaaaag       360
     ggtttacggc cgattgttct cgtgaataaa attgaccgtc cccaagcgga tcctcatggt       420
     gcagtagaca aggtccttga tctatttata gaactgggag cggatgatga tcagtgcgat       480
     ttcccttatc tatttgcctc tggcttggat ggctatgcca aggaagattt agacgcccct       540
     ggcgaggata tgaaaccact gtttgagtca ttcctccacc atgttccacc cccagttggt       600
     gatcctgaga agcccttaca gctacaggtc accaccctgg actattccga ttatctaggc       660
     cggattgtga ttggcaaaat tcacaatggc acgatcaata tgggacagca ggctgcctta       720
     atcaatgaac atggcgagat ggtcaaagcc aaagtcagca agttgatggg gtttgaaggt       780
     ctacagagag ttgagttagc gactgcttct gccggtaacc tggttgcgat cgcagggttt       840
     gccaatgcca atatcggcga aaccattacc tgtcccaacg aaccccaagc ccttccccta       900
     attaaggtgg atgaacctac cctgcaaatg actttctgcg tcaacgactc gccatttgcg       960
     ggtcaggaag gagactttgt cacctcaaga caaattcgcg atcgcttgat gcgtgagctg      1020
     gaaaccaacg tcgcgctgcg ggtcgaagaa acggattccc ccgatcgatt tgctgtttcc      1080
     ggccgaggtg aattgcactt gggcattttg attgaaacca tgcgccgaga agggtatgag      1140
     tttcaagtat cccaacctca ggtgatttat cgggaagtga atggtcagcc ctgtgaaccc      1200
     tatgagtatt tggtgctaga tgttcctgaa gaggctgtgg ggggctgtat tgagcgcttg      1260
     ggacaacgcc ggggcgaaat gcaggatatg caggtgagca atggccgcac ccaactcgaa      1320
     tttgtgattc cagcccgagg cttgattggt tttagaggcg agtttatgcg cctaacccga      1380
     ggcgatggca ttatgaacca cagcttcttg gagtaccgag agatggctgg ggatatttcg      1440
     tctcgacgga atggggtaat tattgccttt gaggaaggaa cggctacgtt ctatgccctt      1500
     aagaatgcgg aagatcgagg ctctttcttt attgagccgg gggtcaaagt ctacaaaggc      1560
     atgattgtgg gtgagcataa ccgtcctcag aatctggatc tcaacgtttg caaaaccaag      1620
     cacctcacca atcaccgtag ttcaacgggc gatgagctag tacagctgca agcaccggtt      1680
     gatatgagcc tagagcgggc gctggaatat atcggtccag atgaactagt ggaggtcact      1740
     cctgaatcgg tacgtctacg aaaactagaa aagaaaaagc tcgccaagcg ttag            1794
//

If you have problems or comments...

PBIL Back to PBIL home page