(data stored in ACNUC7421 zone)

EMBL: CP000859.PE1

CP000859.PE1         Location/Qualifiers
FT   CDS_pept        50..1432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; KEGG: sfu:Sfum_0001
FT                   chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65811"
FT                   /db_xref="GOA:A8ZRP4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP4"
FT                   /protein_id="ABW65811.1"
FT                   /translation="MDSVWKKVKADLKTHVPLNNYMMWIEPLEFESAQPDTLVLNCPNS
FT                   FSKKWVAGNYEKLIAEKVCGLCGKQVHLRLEVAPPGTGAKKQSPAPDSTAIPSGTHTRS
FT                   DAQLTLPSVQVKPATGRVLKADYTFDNFVVGNHNDFAYTAVLSLGARQQSGGRSLFLSS
FT                   RPGMGKSHLAQALGHQTIKAQPGCRVYYTTVEDFSNEMVYAYTTKSSGAFKKKYRTGFD
FT                   MLLIDDIHALAGKDRTQEELAMVVDYMLEADRKVLFAGCCLPGEIPKMNDQLKSRLSCG
FT                   LITTMETPDFTTRVRILEKKARFYGYAVPRDILEYLADVLTEDVRQLESGLANLATKSC
FT                   LLGVPMDRELAESIIKNMAVRNGAITLDAIKKVVCKAYGLAAKEIDSRSRKHRVAWPRQ
FT                   VAIYLSRRYTDHSLKAIGRSYNRYHATVLHSINTVEQAMKANRSVFQEVDYIIQKIESG
FT                   KI"
     atggactctg tctggaaaaa agtaaaagct gacttaaaaa cgcatgtgcc gttaaacaac        60
     tacatgatgt ggattgagcc cctggagttc gaatccgcac agcccgacac ccttgtgctg       120
     aactgcccca actccttttc caaaaaatgg gtggccggca actacgaaaa actgattgcc       180
     gagaaggttt gcgggctctg cggaaaacag gtccaccttc gcctggaggt ggcccccccg       240
     ggtaccggcg caaaaaagca gtcgccggca ccggattcaa ccgccattcc ctccgggaca       300
     cacacccggt ccgacgccca gctgacgctg ccctctgtcc aggttaaacc cgccacgggc       360
     cgggtactca aagccgatta cacttttgac aacttcgtgg tgggcaacca taacgatttt       420
     gcctataccg cggtcctctc cctgggagcc cggcaacagt ccgggggccg gtccctgttt       480
     ctctcctccc ggccgggcat gggcaaaagc catctggccc aggcactggg ccaccagacc       540
     ataaaagccc agcccggatg ccgggtctat tacaccacgg tggaggattt ttccaacgag       600
     atggtgtacg cctacaccac caagtccagc ggcgccttta aaaagaagta ccgcaccggg       660
     tttgacatgc tgctgatcga tgacattcat gccctggccg gaaaagaccg cacccaggag       720
     gagctggcca tggtggtgga ctacatgctg gaggccgacc gaaaggtgct gtttgccgga       780
     tgctgcctgc ccggtgaaat tcccaaaatg aacgaccagc tcaagagccg cctctcctgc       840
     ggcctgatca ccaccatgga aaccccggac tttaccaccc gggtccgcat tctggagaaa       900
     aaggcaagat tttacgggta tgccgtgccc cgggacattc tcgaatacct ggccgatgtg       960
     ctgaccgaag atgtgcgcca gctggaaagc gggctggcca acctggcaac caagtcctgc      1020
     ctgctgggcg tgcccatgga cagggagctg gccgaaagca tcatcaaaaa catggcggtg      1080
     cgaaacggcg cgatcaccct ggatgccatc aaaaaggtgg tgtgcaaggc ctacggactt      1140
     gccgccaaag agatcgactc ccggtcccgc aagcaccggg tcgcctggcc ccggcaggtg      1200
     gccatctacc tctcccggcg ctataccgac cactccctca aagccatcgg ccgcagctac      1260
     aaccggtacc acgccacagt gctgcactcc atcaacaccg ttgagcaggc aatgaaggca      1320
     aaccgctcgg tttttcagga agtggactat attattcaga aaatagaatc cggcaagatt      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page