(data stored in ACNUC7421 zone)

EMBL: CP000859.PE103

CP000859.PE103       Location/Qualifiers
FT   CDS_pept        115053..116078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0103"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; KEGG: dvl:Dvul_1916 single-stranded nucleic
FT                   acid binding R3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65913"
FT                   /db_xref="GOA:A8ZSK0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK0"
FT                   /protein_id="ABW65913.1"
FT                   /translation="MTDTKEFEGKNIDAALEKASSALNMTKDQLRYEVVCTGSSGIFGL
FT                   VGVKNARIRILNSKKGSGGAGAGGRRDVLDEDRQEILSMLDEAFAEPAPEPESRPRPEA
FT                   KAAPRGEPRAESKKAPRAKPKSRPRTEKGAPAPAERSRAAGRPPANGAKPPAPEERPET
FT                   PPAASEELPESPPAPPVEVKEADVVLARDVLSKILDNITDEATVKVAFEPGRVGFSMEG
FT                   GNSSVLIGKRGKTLKAMQHIVEKVVKKSMGEAVEVQVDVEGYLEKRASSLTTLASRLAE
FT                   KARQTGKPTTISRMDAYERKIIHDALRTDRSVKTRSVGNGDIRNVVIHPGRRTSRKKTA
FT                   P"
     atgaccgaca caaaagagtt tgaaggcaaa aatattgacg cggccctgga aaaggccagc        60
     agcgccctta acatgaccaa agaccagttg cgctacgagg tggtctgtac cgggtccagc       120
     ggcattttcg ggctggtggg ggttaaaaac gcccgcattc gaattctcaa ttcgaaaaaa       180
     gggtcggggg gcgccggagc agggggcagg cgggacgtgc tggacgagga ccggcaggag       240
     attctctcca tgctggacga ggcttttgcc gaaccggccc ctgaacccga aagccggccc       300
     aggcccgagg ctaaagcagc gcccagggga gagcccaggg ctgagtcgaa aaaagcgccc       360
     agggccaaac ccaaatcccg gccccggacg gaaaaagggg ctcctgcccc ggctgaacgg       420
     tcaagggcgg ccggccggcc gccggcaaac ggggccaagc cccctgcacc ggaggagcgc       480
     ccagagacac cgccggccgc ttcagaggaa ctgccggaat cgccgccggc accgcctgtt       540
     gaggtgaaag aggcggacgt ggttctggcc cgggacgttt tgagtaaaat actggacaac       600
     atcaccgacg aagccacggt gaaagtggcg ttcgagccgg gccgggtcgg tttttccatg       660
     gagggcggca actcatcggt gctcatcggc aagcgcggca aaaccctgaa ggccatgcag       720
     catattgttg aaaaggtggt taaaaaatcg atgggtgagg cggtggaggt gcaggtggac       780
     gtggaagggt atctggaaaa acgggcatcc tccctgacaa cccttgcctc ccgtctggct       840
     gaaaaggccc ggcagaccgg caagcccacc accatcagcc gaatggacgc ctacgagcgg       900
     aagatcattc atgacgccct gcggaccgac agaagcgtga aaacccgcag cgtgggaaac       960
     ggggacattc gaaacgtggt gatccatccc ggacggcgga ccagccgtaa aaaaacggcg      1020
     ccataa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page