(data stored in ACNUC7421 zone)

EMBL: CP000859.PE105

CP000859.PE105       Location/Qualifiers
FT   CDS_pept        117620..118303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0105"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dde:Dde_3774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65915"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK2"
FT                   /protein_id="ABW65915.1"
FT                   /translation="MEFDFTPYFTRYEMLVSMVDGIFDRVKDEYPACVTCSQGCSDCCH
FT                   ALFDLTLIEALYINHKFNAAFGRNEQMLEKANRADRQIYKLKKQAYLDHEQGKNEVAIL
FT                   AEMGMERVRCPLLNNEEMCDLYAFRPITCRIYGIPTSISGMSHTCGKSGFEAGGKYPTL
FT                   NMDKIYSQLYALSRELMVDIQTRYTKMDEMLVPVSMALLSDYDDAFFGFNQEAENTEDG
FT                   KEEKE"
     atggagtttg attttacccc gtattttacc cggtatgaaa tgctggtgag catggtggac        60
     ggcatctttg accgggtcaa ggacgagtac cccgcctgcg ttacctgcag tcagggctgt       120
     tcggactgtt gtcacgccct ttttgatctg accctgatcg aggccctcta catcaaccac       180
     aagttcaacg cggccttcgg gcgcaacgaa cagatgctgg aaaaggcaaa ccgggccgac       240
     cgtcagattt acaagttaaa aaagcaggcc tacctggacc acgaacaagg caagaacgaa       300
     gtggccattc tggcggaaat gggcatggag cgggtccggt gccccctgct taacaacgaa       360
     gagatgtgcg acctgtatgc gtttcgaccc attacctgcc ggatttacgg tattcccacc       420
     tcgatttctg gaatgagcca cacctgtggc aaaagcggat ttgaggccgg cggaaaatac       480
     cccaccctta atatggataa gatttattct cagctttacg ccctttcccg ggagctgatg       540
     gtcgacattc agacccggta caccaaaatg gacgaaatgc tggtgccggt ttcaatggcc       600
     cttctctccg actacgatga cgcgtttttc gggtttaacc aggaagcgga gaacacagag       660
     gacgggaaag aggagaaaga atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page