(data stored in ACNUC7421 zone)

EMBL: CP000859.PE110

CP000859.PE110       Location/Qualifiers
FT   CDS_pept        121442..121936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65920"
FT                   /db_xref="InterPro:IPR021471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK7"
FT                   /protein_id="ABW65920.1"
FT                   /translation="MKTPRCMVRIGMAVLVCLMVFLSTAGAESVLPLSTGQTLYVPAYS
FT                   HIYSGNNEQPFLLTVTLSIRNIDPGRAILVTKADYYATQGKQLKSYVSAPVKLKPLESI
FT                   RYVVPERDKSGGSGANFIVEWTSDGPVNPPIVESIMIGTQIQQGISFTSRGQPITPFSS
FT                   Q"
     gtgaaaacac cacgctgtat ggtccgtatc gggatggccg ttctggtctg cctgatggtt        60
     tttctgtcca cagccggggc agagtctgtg ttgccgctct ccacgggcca gaccctttac       120
     gtgccggcct attcccatat atacagcggt aacaacgagc agccctttct tttgaccgtg       180
     accctgagca ttcgcaacat cgaccccggc cgcgccattc ttgtcaccaa agcggactac       240
     tatgcaacac agggaaagca gctgaaaagc tatgtctcgg cgccggttaa gttaaagccg       300
     ttggaatcca tacgctacgt ggtgccggaa cgggacaaaa gcggcgggtc gggcgccaac       360
     tttattgttg agtggacatc cgatggcccg gtcaatccac ccattgtcga gtccatcatg       420
     atcggcaccc agattcagca gggcatctcc tttacttcca ggggccagcc cattaccccc       480
     ttttcctctc aatag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page