(data stored in ACNUC7421 zone)

EMBL: CP000859.PE117

CP000859.PE117       Location/Qualifiers
FT   CDS_pept        129053..129430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0117"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mka:MK0462 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65927"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL4"
FT                   /protein_id="ABW65927.1"
FT                   /translation="MATGLSLKERFDIPEYDDMAAMHYALLDFDQEKCVQCGLCVSACA
FT                   GGCILIGSLYRSDFISGQGKARQGFPELDTLPNQTPMCVGCLTCSAACPTGAITIKQPF
FT                   RPGGRLKKLHQAPEMTPPHRY"
     atggccaccg gcttaagcct gaaagagcgg tttgacattc ccgaatatga cgacatggcc        60
     gccatgcact atgccctgct ggattttgac caggaaaagt gtgtacagtg cggtctttgc       120
     gtgtctgcct gcgccggcgg ctgcattctt atcggcagcc tttaccggtc cgattttatt       180
     tcaggacagg gcaaagcccg gcagggcttt ccagaactgg acacccttcc gaaccagacc       240
     cccatgtgcg tggggtgcct tacctgctcg gcggcctgcc ccaccggtgc catcaccatc       300
     aagcagccct ttcgtcccgg cggccgcctg aaaaagctgc accaggcccc ggagatgacc       360
     ccgcctcacc ggtattga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page