(data stored in ACNUC7421 zone)

EMBL: CP000859.PE118

CP000859.PE118       Location/Qualifiers
FT   CDS_pept        129618..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65928"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL5"
FT                   /protein_id="ABW65928.1"
FT                   /translation="MRPVRQLFLLPFLLLVFASSGLCFTDVTTLEFKGFTLGMSLEQAV
FT                   KTLKARAYRENRDIRVFSSGEYAISAYFQNDIPLHLVSAKESDYTDMTLQFANNELLML
FT                   DAKTRYVTADQARALPDKYTRIFGPFDFRGEKLSRDTAVLFWLWGGESIRPETPPMAPH
FT                   VQVQIISKRENGKETPESEELRMVDVPKLMGVQYAETLEQYLKGNALYAAKVEEGRKLA
FT                   AGHIPKIQAAIDGDDRYRQVKLNPFEDTILVSGVVKQGDLNPLKEMVAATDPPLKITWN
FT                   VREYPAEVFKQK"
     atgcgccccg tcagacagct ttttcttttg ccgtttcttc ttctggtttt tgcttcttcc        60
     ggcctgtgct ttaccgatgt gaccaccctt gagtttaagg gctttacgct gggcatgtcc       120
     ctggagcagg cggtcaaaac cttaaaggcc cgtgcgtaca gggaaaacag ggacatacgg       180
     gttttcagca gcggggagta tgccataagc gcctattttc aaaacgatat tccccttcac       240
     ctggtttcgg ccaaagagag cgactacacg gatatgaccc tgcagtttgc aaacaacgaa       300
     ctgctgatgc tggatgcaaa aacccggtac gtaaccgcgg accaggccag ggccctgccg       360
     gataaataca cccggatctt tggcccgttt gattttcgcg gcgagaagct ttcccgcgac       420
     acggccgttt tgttctggct ctggggcggg gaatccattc gcccggaaac gccgcccatg       480
     gcccctcatg ttcaggtgca aatcatcagc aaaagggaaa acggaaaaga gaccccggaa       540
     agcgaagagc ttagaatggt ggatgttcca aaactgatgg gggtacaata cgcggaaaca       600
     ctggagcagt acctcaaggg caacgcgctt tacgcggcaa aggtagaaga aggccgcaaa       660
     ctggccgcgg ggcatatacc aaagattcag gccgccattg acggcgacga ccgttaccgg       720
     caggttaagc tcaatccttt tgaagacacg attctggtct ccggcgttgt aaagcagggc       780
     gacctgaacc cccttaaaga gatggtcgcc gcaaccgatc cccccttgaa aataacctgg       840
     aacgtgcgtg aatacccggc cgaggttttc aaacaaaaat ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page