(data stored in ACNUC7421 zone)

EMBL: CP000859.PE120

CP000859.PE120       Location/Qualifiers
FT   CDS_pept        131723..132865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0120"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: dps:DP3095
FT                   probable carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65930"
FT                   /db_xref="GOA:A8ZSL7"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL7"
FT                   /protein_id="ABW65930.1"
FT                   /translation="MKALLALEDGRTFACKSFTGPGETGGEIVFNTGMSGYQEVLTDPS
FT                   YRGQIVTMTYPLIGNYGVNHQDVESDRVQVAGFVVREYQDCPSNFRSEQSLAKYLQSQG
FT                   VLGITDLDTRALTRHLRTVGALRACISTHELDPAALVEKALAVPSMAGCDLVTGVFSKK
FT                   PYRWINGAPAAVDMDLADMDERVWHKTGGFRVAAFDFGIKYNILRNLEAAGFQVLVVPA
FT                   GATAAQVKQVNPDGIFLSNGPGDPEPLTGPVATIRELLDYRPMFGICLGNQLAGLALGG
FT                   ATYKLKFGHRGANQPVKDLETGKIEITSQNHGFAVDIDSLKKENLVVTHINLNDNTLEG
FT                   FAHKDIPLFTVQYHPEASPGPHDARYLFDRFKALIEKTHA"
     atgaaagccc tgcttgccct tgaagacggg cggacctttg cctgcaaaag ctttaccgga        60
     cccggagaaa ccggcgggga gatcgtgttt aacaccggca tgtccggcta ccaggaggta       120
     cttaccgatc cctcctaccg gggccagatc gtgactatga cctatcccct tatcggcaac       180
     tacggggtca accaccagga tgtggagtcg gaccgggtcc aggtggccgg ttttgtggtg       240
     cgcgaatacc aggactgccc cagcaacttc cggtccgagc agtccctggc aaaatacctg       300
     caaagccagg gcgtgctggg catcaccgac ctggacaccc gtgccctgac ccgccacctt       360
     cgcacagtag gggcgttgcg ggcctgcatc tccacccacg aactcgatcc cgcggccctg       420
     gtagaaaagg cgcttgccgt gccgtccatg gcagggtgcg accttgtcac cggcgtgttt       480
     tcaaaaaagc cctatcgctg gatcaacggg gcgccggccg ccgtggacat ggacctggcc       540
     gatatggatg agcgggtgtg gcataaaacc ggtggctttc gggtggcggc ctttgatttc       600
     ggcatcaagt acaacattct gagaaatctt gaggcggccg ggttccaggt gctggtggtg       660
     cctgccggtg ccacggccgc ccaggtaaaa caggtcaacc cggacgggat ttttctgtcc       720
     aacgggccgg gcgaccccga gccgttgacc gggccggtgg ccaccattcg cgagcttctg       780
     gactaccggc ccatgttcgg catctgcctg ggaaaccagt tggccggcct ggccctgggc       840
     ggcgccacct acaagctcaa gttcggccac cggggcgcca accagccggt aaaggacctt       900
     gaaaccggaa aaatcgaaat cacctcccag aaccacgggt ttgccgtgga tatcgacagc       960
     ctgaaaaaag aaaatctcgt ggtgacccac atcaacctca acgacaacac cctggagggg      1020
     tttgcccaca aagacattcc cctgtttacc gtccagtacc atcccgaggc atccccgggt      1080
     ccccacgacg cccggtacct gtttgaccgg ttcaaagccc tgatagagaa aacccatgcc      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page