(data stored in ACNUC7421 zone)

EMBL: CP000859.PE133

CP000859.PE133       Location/Qualifiers
FT   CDS_pept        complement(147111..147398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65943"
FT                   /db_xref="GOA:A8ZSN0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN0"
FT                   /protein_id="ABW65943.1"
FT                   /translation="MRRTSLLADQEPVISWHDTTAVYGIAAGFALAVMLFAGAGISVAG
FT                   EKAEFSHYVWVAWLLLVLGAVVLMASMLRLGRRLFLAIERYRDKGPGLPL"
     atgagacgga catccctttt agcggaccag gaaccggtta tttcctggca cgacaccacc        60
     gccgtttacg gcattgcggc ggggtttgcc ctggcggtga tgctctttgc cggggccggc       120
     atctccgtgg ccggtgaaaa ggccgaattt tcccactacg tatgggtggc gtggctgctg       180
     ctggtgctgg gggccgtggt gctgatggca agcatgctcc gcctgggccg gcggctattt       240
     ctggccattg agcggtaccg ggacaagggg ccgggcctgc cgctataa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page