(data stored in ACNUC7421 zone)

EMBL: CP000859.PE138

CP000859.PE138       Location/Qualifiers
FT   CDS_pept        151327..152805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0138"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: pfu:PF0532
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65948"
FT                   /db_xref="GOA:A8ZSN5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN5"
FT                   /protein_id="ABW65948.1"
FT                   /translation="MTDPIEAHRLYGMTHPKSVAIFGASNNHSSMGTIILRAMMAFDFP
FT                   GKIYPVHLKEKEVQGLTAFDSVESLPEAPDLAVIVLPTRIVCETMEACGKKGIRNAIVV
FT                   SGGFKEVGPEGAEREKELAAIAGKYGISIIGPNCLGVTNAHARLNTTPHRYYGKPGFIG
FT                   LVSQSGSFVTQMFAYLDQLHLGFSTAFSIGNEVNTDLVDCLEFLGACPDTKVIALYVEA
FT                   IRRGRKFVETARKIVPHKPIVALYVGGSETGRKAALSHTGSMSGPDDLYSGIFRQSGVI
FT                   RVSSITELFDCCMAFGHLPQPAANRVFIQTHSGGPGAVAADACGRSGLVLPEPSAKTAE
FT                   KLKALVPATGSVKNPIDLTFTKDMTQFFADIPGVLLEDPGCDALMFYYYTPADMIKRVL
FT                   LQMGVPAAELDAKMDEVSQHISAQMQGLIKRSGKPVFCFSYQGRSETAVQSLSALGVPF
FT                   YQGPERAVRALAAMVAYGTLKEKIVRQSGIDPSA"
     atgaccgacc cgattgaagc ccaccggctc tatggcatga cccacccgaa atctgtcgct        60
     attttcgggg cttccaataa ccactcctcc atgggcacca tcattctgcg ggccatgatg       120
     gcgtttgatt ttcccggaaa aatctatccg gttcatctca aggaaaaaga ggtgcagggc       180
     ctgaccgcct ttgacagtgt tgagtccctg cccgaggccc cggacctggc cgtgatcgtg       240
     ctgcccaccc gaatcgtgtg cgagacgatg gaggcctgcg ggaaaaaggg cattcgcaac       300
     gccatcgtgg tgtccggtgg tttcaaggag gtgggaccgg aaggggccga gcgggaaaaa       360
     gagctggccg ccattgccgg taaatacggc atcagcatca tcggccccaa ctgcctgggc       420
     gtcaccaacg cccatgcccg gctcaacacc acgccccacc ggtattacgg aaagccgggg       480
     tttatcggcc tggtctcaca aagcggcagt ttcgtgaccc agatgtttgc ctacctggac       540
     cagcttcacc tgggcttttc cacggccttc agcatcggca acgaggtcaa taccgacctg       600
     gtggactgcc tggagttcct gggggcctgc ccggacacaa aggttatcgc tctttacgtg       660
     gaggccattc gccggggccg caagtttgtt gaaacggcgc gaaagatcgt tccccacaaa       720
     cccatcgtgg cgctttacgt gggcggatcg gaaaccggcc gcaaggcggc cctttcccac       780
     accgggtcca tgtccggacc cgatgacctc tattcgggca tcttccggca gagcggcgtg       840
     atccgggttt cgtccatcac cgagctgttt gactgctgca tggcgttcgg ccatctgccc       900
     cagcccgcgg ccaaccgggt ctttattcag acccactccg gcggccccgg ggccgttgcc       960
     gctgatgcct gcggccggtc cgggcttgtg ctgcccgaac cctcggcgaa aaccgctgaa      1020
     aagctcaaag ccctggtgcc ggccacgggc agcgtgaaaa atcccattga cctgaccttt      1080
     accaaggaca tgacccagtt tttcgccgac attcccggcg tcctgctgga agatcccggt      1140
     tgcgacgccc tgatgttcta ttattatacg cccgcggaca tgatcaagcg ggtgctcctg      1200
     cagatgggcg taccggccgc tgaactggac gccaagatgg acgaggtgtc gcaacacatt      1260
     tccgcccaga tgcagggact catcaagcgg tccggcaagc cggtattctg cttttcctac      1320
     cagggccggt ctgaaactgc cgtccagtcg ctttcggccc tgggcgttcc cttttaccag      1380
     ggtccggaac gggccgtgcg cgcgcttgcg gccatggtgg cctacggcac gctcaaggaa      1440
     aaaatcgtcc gccagtccgg catcgatccc tcggcctga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page