(data stored in ACNUC7421 zone)

EMBL: CP000859.PE139

CP000859.PE139       Location/Qualifiers
FT   CDS_pept        152951..153283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0139"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: mms:mma_0858
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65949"
FT                   /db_xref="GOA:A8ZSN6"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN6"
FT                   /protein_id="ABW65949.1"
FT                   /translation="MDIDSLAASQGFTTEEFLEIVDVFIDVSRSDVVRMTEAIENQDAA
FT                   TAGDAAHSLKGAAGNLGFFDLFDAAKKAETQAKSNDLGQARETLSHVRDMVEAIARDVR
FT                   HKDAAP"
     atggacatag attcacttgc cgccagtcag ggctttacca ccgaggagtt tctggaaatc        60
     gttgatgtgt ttattgatgt ttcccggagc gacgtggttc gcatgacgga ggcgattgaa       120
     aaccaggatg ccgcaacagc gggggacgcg gcccactcat tgaagggggc tgccggcaac       180
     ctggggtttt ttgacctgtt tgatgcggcc aaaaaagcgg aaacgcaggc caagtccaac       240
     gacctgggcc aggcccggga gacgctttcg catgttcgcg acatggtcga ggcgattgcc       300
     agagatgttc ggcacaaaga tgccgcgccg tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page