(data stored in ACNUC7421 zone)

EMBL: CP000859.PE142

CP000859.PE142       Location/Qualifiers
FT   CDS_pept        155249..156262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0142"
FT                   /product="Protein of unknown function DUF933"
FT                   /note="PFAM: Protein of unknown function DUF933; KEGG:
FT                   sfu:Sfum_4023 protein of unknown function DUF933"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65952"
FT                   /db_xref="GOA:A8ZSN9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSN9"
FT                   /protein_id="ABW65952.1"
FT                   /translation="MKLGLIGKPGAGKKTLFEALTKSDPDSGHKGDLRIAAIYVPDPRV
FT                   DVLSAMYSPRKTIYAQIEYCLGRTAGDKDLQLKAVADCDALIQVVRNFPVPGMPDPSPY
FT                   KDIAAMDEDLMLSDFVVIEKRLERIAADAKRGKKADAQEMALLDQVKQMIENGTPVRTQ
FT                   PEIATAPLLRGFSLLSAKPVLVLINNDEDDTALPAGPPPGGIDLMVVRGKLEHEISRMS
FT                   DDEAAEFLKEFGIDEPAIHRALRRSYAMLGLISFFTVGEDEVRAWTIKKGALAPEAAGT
FT                   IHSDMQKGFIRAEVVAYDALMAAGSYAEARKQGTVRLEGKTYEMADGDIVNIRFNV"
     atgaaactgg gactgatcgg aaaacccggg gccggcaaaa agaccctttt tgaggcactg        60
     acaaaaagcg acccggacag cggccacaag ggtgatcttc gcatcgcggc catttacgtg       120
     cccgaccccc gggtggacgt gctgtctgcc atgtacagcc cgcgcaaaac catctacgcc       180
     cagatcgaat attgcctggg ccggaccgcc ggagacaagg accttcagtt aaaggccgtg       240
     gccgactgcg acgccctgat ccaggtggtg cgaaactttc cggttcccgg catgccggac       300
     ccgtcgccgt ataaagatat cgccgcaatg gatgaagacc tgatgctgtc tgactttgtg       360
     gtaattgaaa agcggctgga gcgcattgcc gccgacgcca agcggggcaa aaaggccgat       420
     gcccaggaga tggccctgct ggaccaggtc aaacagatga ttgaaaacgg caccccggtg       480
     cgcacccagc ccgagattgc caccgcgccc ctgctgcggg gtttttccct tctgtcagcc       540
     aaaccggtgc tggtgctgat caacaacgac gaggatgaca cggccctgcc cgccggcccg       600
     ccgcccgggg gaatagacct gatggtggtg cggggaaagc tggagcatga gatttcccgc       660
     atgtccgatg acgaggccgc cgaattttta aaggagttcg gcattgacga gcccgccatt       720
     caccgggccc tgcgccggtc ttatgccatg ctggggctga tctctttttt caccgtgggc       780
     gaggatgagg tgcgggcctg gaccattaag aaaggggcac tagccccgga ggcggccggt       840
     accattcatt cggacatgca gaaagggttt attcgggccg aggtggtggc ctacgacgcc       900
     ctgatggcgg ccggcagcta cgcggaggcc agaaagcagg gcacggtgcg gctggagggc       960
     aaaacctacg agatggccga cggcgatatc gtgaatattc gatttaatgt gtaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page