(data stored in ACNUC7421 zone)

EMBL: CP000859.PE146

CP000859.PE146       Location/Qualifiers
FT   CDS_pept        complement(159793..160650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65956"
FT                   /db_xref="GOA:A8ZSP3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP3"
FT                   /protein_id="ABW65956.1"
FT                   /translation="MQEFNLDKKFKRLMKGCLVVFVAFLFLGLALPFFPGDGKGSTEGA
FT                   LILSIICTIVFGFFTILIWRTLKKLPCVDIIVDNDGLWYKHKQKKDGLVPWKKIGKIKE
FT                   RLYLQCLDILDSDGRKLIRIEYQLNNFEVLRNILNDKLSDWLPKSQQSSFSKNVLYHFF
FT                   YGACIIGFSWLGLYVGRHSNPWFGYIGMGILVIIILYEYLATAYRLDLIDNGLLIVYPT
FT                   SKKTIAYSDISSIKMADTFQKGARFPEVWVTVKNGSKPYKLKQLGVDANSLFITLKKAK
FT                   ELKA"
     atgcaagaat ttaatttaga caaaaagttc aaacgcttaa tgaaaggctg cttagttgtc        60
     tttgtggctt ttctattttt agggcttgcc ctcccctttt ttccaggcga tgggaaagga       120
     agtactgagg gtgcattgat tctatcaata atttgtacga ttgtttttgg ctttttcaca       180
     attctgatct ggcgaacgtt aaaaaaattg ccctgtgttg acataattgt tgataatgat       240
     gggctatggt acaaacacaa acaaaaaaaa gatggtcttg tgccatggaa aaaaattggc       300
     aaaattaaag aacgcttata tctgcaatgc ctggacatac tggattcaga tgggcgtaaa       360
     cttatcagaa tagaatatca actaaataat tttgaggtat taagaaacat attaaacgat       420
     aagctttctg attggctccc aaagagtcag caaagttctt tttcaaaaaa tgttttgtat       480
     catttttttt atggtgcttg cattataggc ttttcttggt taggtcttta tgtcgggaga       540
     catagcaacc cctggtttgg ctatatagga atgggcatcc ttgttataat aatcctctat       600
     gaataccttg caactgccta ccgccttgat cttatcgaca acggtctatt gatagtttat       660
     ccaacaagca aaaaaaccat tgcttactca gatatttcaa gcattaaaat ggctgacacc       720
     tttcaaaaag gtgcaagatt tccggaggta tgggttacag taaaaaacgg cagcaaacca       780
     tacaaattga agcaacttgg tgttgatgca aacagtttgt ttataacctt aaaaaaagct       840
     aaggagctaa aagcatag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page