(data stored in ACNUC7421 zone)

EMBL: CP000859.PE148

CP000859.PE148       Location/Qualifiers
FT   CDS_pept        complement(161253..162740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0148"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   gur:Gura_4178 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65958"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSP5"
FT                   /protein_id="ABW65958.1"
FT                   /translation="MPKKTMKPYWMAGLLMAGLFAVLLGMRFGLFSGLMNPSLPGAAHL
FT                   ADQVLPEQDTWMSILQNDKKIGYSHSRLFKTADGYAVAETVFLNITAMGMRHAVKLNTS
FT                   AVLHPDLTVDTFSFKMDSGRLSFSAQGRVADGRAVVNTTADGKTQSFEIPLQEAPYLPS
FT                   GVLHAVTNSSMAPGESMTFSMFDPSIMATTPVTVTVVGKETITVLGVDRITTKIHMRMK
FT                   QAEQFAWLSEDGEVVKESGLMGLTLVKAEKYDAIAGLSEDAADLVELVAVDAGVRFDNP
FT                   SALKWLAVEISGIDINPDRLSSVRQSFDEQVLTITKESLYGRGDRVPAGRLAPFLLADP
FT                   FVQSDDPAIRELAARITKDHSEPVKKAQALIDWVYTEIEKRPVVSLPNALSTLRTRQGD
FT                   CNEHAVLLAALARAAGIPAGIETGLVYLDGKFFYHAWNSLYVGKWITADATFGQFPADV
FT                   THIRLAGGTGEGLLDLMGIIGKIQLKVVAFEPAGSQQ"
     atgccgaaaa aaaccatgaa accctactgg atggccggcc ttctgatggc cggcctgttt        60
     gccgtgctgc tgggcatgcg cttcggcctt ttttccggcc tgatgaaccc ctccctgccc       120
     ggcgccgccc acctggccga ccaggtgctg ccggagcagg acacgtggat gagtatcctg       180
     cagaacgaca aaaaaatcgg ctattcccac tcccggttgt ttaaaacagc agacggctac       240
     gcggttgctg aaaccgtttt tttaaacatc acggccatgg gcatgcgcca cgctgtcaaa       300
     ctgaacacct ccgccgtgct tcacccggac ctgaccgtgg acacgttttc ttttaagatg       360
     gattcgggcc ggctctcctt ttccgcccag ggacgggtgg cggatgggcg ggctgttgtc       420
     aacaccacgg ccgacggcaa gacccagtcc tttgaaatcc ccctgcagga ggccccctac       480
     ctgccgtctg gtgttcttca cgccgtcacc aactccagca tggcaccggg cgaatccatg       540
     accttttcca tgttcgaccc atccatcatg gccaccacac cggtcacggt cacggttgtg       600
     ggaaaagaga ccatcacggt gttgggtgtt gaccggatta ccacaaaaat tcacatgcga       660
     atgaagcagg ccgaacaatt tgcctggctc agcgaggacg gtgaggtggt aaaagagtcc       720
     ggcctcatgg ggctgaccct tgtaaaggcg gaaaaatacg atgccatcgc cggcctgtcc       780
     gaagatgcag cggacctggt ggagctggtg gccgtggatg ccggggtccg gtttgacaat       840
     ccttcggccc ttaaatggct ggcagtggaa atcagcggca tcgacatcaa tccggaccgg       900
     ctctcttcgg tccgccagtc gtttgacgaa caggtgctga ccatcacaaa agagtcgctt       960
     tacggccggg gggaccgggt tccggccggc cggctggcgc cctttctgct ggcagacccc      1020
     tttgtccagt ccgatgatcc ggccatcaga gagcttgcgg cgcgcatcac aaaagaccac      1080
     agcgaaccgg tcaaaaaagc acaggccctg atcgactggg tctacaccga aattgaaaaa      1140
     cggccggtgg tgtccctgcc caacgccctt tccacccttc gcacccggca gggcgactgc      1200
     aacgaacacg ccgtgctcct ggcggccctg gcacgagccg cgggcattcc cgccggtatt      1260
     gaaaccgggc tggtctacct ggacggaaaa ttcttctacc acgcctggaa ctcgctttat      1320
     gtggggaaat ggatcaccgc ggacgcgact ttcggccagt ttccggctga cgtcacccat      1380
     atccgcctgg ccggcggcac cggcgaagga ctgctggacc tgatgggcat catcggcaaa      1440
     attcaactga aggtcgttgc gtttgaaccg gcggggtcgc agcaatag                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page