(data stored in ACNUC7421 zone)

EMBL: CP000859.PE152

CP000859.PE152       Location/Qualifiers
FT   CDS_pept        complement(166507..166794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0152"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: tte:TTE0606 Asp-tRNAAsn/Glu-tRNAGln amidotransferase
FT                   C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65962"
FT                   /db_xref="GOA:A8ZSP9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZSP9"
FT                   /protein_id="ABW65962.1"
FT                   /translation="MKITPDDIRHVAKLARLDIAETDINAFVSQIGEILDYVDTLNQVA
FT                   TENVEPMAHAISLTNAFREDTVREAGPVEKILNNAPAAADNMFCVPKIIE"
     atgaaaatta cgcctgatga tattcgccac gtggcaaaac tggcacggct ggatatcgcg        60
     gagaccgaca tcaacgcctt tgtctcccag atcggtgaaa tcctggacta tgtagacacg       120
     ttgaaccagg tggccacgga gaacgtggag cccatggccc acgccatttc gctgaccaac       180
     gcctttcgcg aggacacggt ccgggaagcg gggcctgtgg aaaaaattct caacaacgcg       240
     ccggcagccg cggataatat gttttgcgtg cccaaaatca tagaataa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page