(data stored in ACNUC7421 zone)

EMBL: CP000859.PE153

CP000859.PE153       Location/Qualifiers
FT   CDS_pept        166953..168641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH217 ABC-2 type transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65963"
FT                   /db_xref="GOA:A8ZSQ0"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ0"
FT                   /protein_id="ABW65963.1"
FT                   /translation="MLKTIKTLLAPRILSFKNRIFLSGKTRVAVFGAVGLVLWAGVFAG
FT                   AFRVLTYFESIEDLGDILANKLLSMLFVVMLSLLVFSSIITTLSKLYLSRDLDLVHSLP
FT                   VAARHLFFARWIESTADSSWMVVLFVLPVFLAHGIVYSAGPLFYLAVVLFLLMLCVTSS
FT                   AISATGIAFVVNLISASRLKTIFVFLGLLLFVLLYVAFRMMRPERLVDPEMFATTLVYL
FT                   RSLNAPAPAWLPSTWAYDGVTAALSGNTGALLFNLLLSGACAGSLVVFMLIVAEAVYFS
FT                   GFSRSSSGWADPVTPEDTARRIYRDRSWPAFLPAPARAFFVKEVRTFVRDQSQWSQLFL
FT                   IAALVVIYIYNFKVLPLETSPMPVVWVQNIFAFLNMGLAAFVLTAVTARFAFPAVSMEK
FT                   SAFWIVQCAPVSIRTFLRIKFFVYLVPLFVLTMTLIVVTNLLLNVAGEMMVLSLVTVSL
FT                   MVPAIVAMGVGIGAVYPDFSSENPAQAVSSFGGFVFMATSALYVIAVIVLEAGPASRLV
FT                   FAGLRGRSLSPESWAWIIGSFTTVVALSVLAVVVPLRLGERRLQG"
     gtgctgaaaa caatcaaaac cctgctggcg cccaggatac tgtcgtttaa aaaccggatt        60
     tttctgtccg gaaagacccg ggtggcggtg ttcggcgccg tgggactggt gctgtgggcc       120
     ggggtctttg ccggcgcctt ccgggtgctg acctattttg aatccatcga agacctgggc       180
     gatattctgg caaacaaact gctttccatg ctgtttgtgg tcatgctctc cctgcttgtt       240
     ttcagcagta ttattaccac cctgtccaag ctctatctct cccgggacct ggacctggtg       300
     cactccctgc cggtggcggc ccggcacctg tttttcgccc ggtggatcga aagcacggcg       360
     gacagttcct ggatggtggt gctttttgtg ctgccggtgt ttctggccca cggcattgtt       420
     tacagcgccg gtccgctttt ttacctggcc gtggttttgt ttctgctgat gctgtgcgtc       480
     acgtcctcgg ccatcagtgc caccggcatt gcctttgtgg tcaacctgat ctccgcctcc       540
     cggttgaaaa ccattttcgt gtttctgggg cttttgctgt ttgttctgct gtacgtcgcc       600
     tttcgcatga tgcggcccga gcggctggtg gatccggaga tgtttgccac caccctggtg       660
     tatctgaggt cccttaacgc cccggccccg gcctggctgc ccagcacctg ggcctatgac       720
     ggcgtgaccg ccgccctgtc cggcaacacc ggcgccctgt tgttcaacct gttgctgagc       780
     ggcgcctgtg ccggaagcct ggtggtgttc atgctgattg ttgccgaggc agtctatttt       840
     tcgggatttt ccaggtcatc ctccggatgg gccgacccgg tcacaccgga agatacggcc       900
     cgccgtatct atcgggaccg gtcatggccg gcctttctcc cggcccctgc gcgggccttt       960
     ttcgtaaagg aggtccgtac ctttgtccgg gaccagtccc agtggtccca gctgtttctg      1020
     atcgctgccc tggtggtgat ctatatttac aatttcaagg tgctgcccct ggaaacatca      1080
     cccatgcccg tggtgtgggt gcagaacatt tttgcctttc tgaacatggg gctggccgcc      1140
     tttgtgctga ccgcggtgac ggcccggttt gctttccccg cagtgagcat ggaaaaatcg      1200
     gctttctgga tcgtccagtg cgcgccggtc tccattcgga cctttctgcg aatcaagttt      1260
     ttcgtctacc tggtgccgct gtttgtgctg accatgaccc tgatcgttgt caccaacctt      1320
     ctgctgaacg tggccggtga gatgatggtg ctctcccttg tcacggtatc gctgatggtg      1380
     ccggctatcg tggccatggg cgtgggtatc ggcgcggtgt atcccgattt ttcttcggaa      1440
     aatccggccc aggcggtgag cagtttcggc gggtttgtgt tcatggcaac cagcgcgctt      1500
     tatgtgatcg cggtgatcgt gctggaggcc ggtccggcca gccggctggt ttttgccggc      1560
     ctgcggggcc ggtccctgag cccggagtcg tgggcctgga tcatcggctc ttttacgacc      1620
     gtggtcgccc tgtccgttct tgccgtggtg gttcccctga gattgggaga aaggcggctg      1680
     cagggctaa                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page