(data stored in ACNUC7421 zone)

EMBL: CP000859.PE154

CP000859.PE154       Location/Qualifiers
FT   CDS_pept        complement(168653..169213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2341 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65964"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ1"
FT                   /protein_id="ABW65964.1"
FT                   /translation="MTSKTDPPREPSDELELDFSIADLSDAADMAEMEPPRPKPTAKAS
FT                   DNAVNRFIQTDRHGRDRRRWKRFTIEGAIVMIPQTAFWRMGKTSYIKLGPVKNISMKGL
FT                   AIHYVEKNQKLLGKAATLSIMFPGEGIIVDKIPFRIVGNVKVADLPDDKEVRNLCVAFE
FT                   RLLPMQKMQMEMFIDTYGNELGD"
     atgacatcca aaaccgatcc accgcgggaa ccttccgacg agcttgagct ggacttttcc        60
     attgccgacc tttccgatgc cgccgacatg gcagaaatgg agccgccgcg gccaaagcca       120
     acggcaaagg caagcgacaa tgcggtaaac cgctttattc agacagaccg ccacggccgg       180
     gaccggcggc gctggaaacg gttcaccatt gagggcgcca ttgtgatgat tccccagacc       240
     gccttctggc gcatgggcaa aaccagttac atcaagctcg gcccggttaa aaacatcagc       300
     atgaaggggc tggccattca ctacgtggaa aaaaaccaga aactgctggg caaggcagcc       360
     accctttcca tcatgtttcc aggtgaaggg attattgtgg acaaaatccc tttccgtatt       420
     gtgggcaatg taaaggtcgc cgacctgccc gacgacaaag aggtccgcaa cctctgcgtg       480
     gcctttgaac ggttgttgcc catgcagaaa atgcagatgg aaatgtttat cgacacctac       540
     ggcaacgagc tgggtgactg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page