(data stored in ACNUC7421 zone)

EMBL: CP000859.PE157

CP000859.PE157       Location/Qualifiers
FT   CDS_pept        173580..174560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0157"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: sfu:Sfum_2408 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65967"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ4"
FT                   /protein_id="ABW65967.1"
FT                   /translation="MAHQKVLLTGPTGFIGKRLLYQLDERGYQVRCLVRAGETLDLNLP
FT                   LRQEPEIVYADLLDPDSLPTALDGMDTAYYLVHSMGGRSIRQTRAFVEKDRTVARNFRE
FT                   AADRAGLSRIIYLGGLGDAGDRLSHHLASRHEVARILQAGKVKTTVLRAAVIIGAGGAS
FT                   FEIIRYLVERLPVLLGPRWVYTKSQPIAVENVLAYLCGCLETPETAGRTFDIGGPQILS
FT                   YADLMGMYARVRGLSRTIIGVPLVPIRLSAYWVHFITPVPVGVVLPLAEGLRNRAICRE
FT                   NSIRDLIPIHLTPMETAICNALAEETEGPGKLLSQQACFLPGDLA"
     atggcccatc aaaaagttct tctcaccggc cccaccgggt ttatcggcaa gcggctgctc        60
     tatcagctgg atgagagggg gtatcaggtc cggtgcctgg taagggccgg cgaaaccctg       120
     gacctgaatc ttccgctgcg gcaggaaccg gaaatcgttt acgcggacct tcttgatccg       180
     gattccctgc caacggcgct tgacggtatg gacaccgcct actatctggt gcactccatg       240
     ggggggagaa gcatccgcca gacccgggcc tttgtggaaa aagaccgcac cgtcgcacgc       300
     aacttcaggg aagccgccga ccgggccggc ctttcccgca ttatttatct cgggggcctg       360
     ggggatgccg gagaccggct gtcccatcac ctggccagcc gccatgaggt ggcccggatt       420
     cttcaggccg gaaaggtgaa aaccaccgtg ctgcgggccg cggtcatcat cggggccggc       480
     ggggcctctt ttgaaattat tcggtacctg gtggagcggc tgccggtgct cctcggtccc       540
     cggtgggtgt acaccaaatc ccagcccatt gccgtggaaa atgtcctggc gtatctttgc       600
     ggatgcctgg agaccccgga aaccgccggt cggacctttg acatcggcgg cccccagatt       660
     ttgagttatg ccgatctcat gggaatgtac gcccgggtcc gggggctgtc ccgcaccatt       720
     atcggggtgc ccctggtgcc catccggctt tccgcctact gggtccactt tatcaccccc       780
     gtgcccgtcg gtgtcgtcct gcccctggcc gaagggctca gaaacagggc catctgccgg       840
     gaaaacagca ttcgggatct gatccccatt cacctgaccc ccatggaaac cgccatctgc       900
     aatgcccttg ccgaagaaac agaaggcccg ggaaaattat tgtctcagca ggcctgcttt       960
     ctgccgggag acctggcatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page