(data stored in ACNUC7421 zone)

EMBL: CP000859.PE159

CP000859.PE159       Location/Qualifiers
FT   CDS_pept        175179..175652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0159"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sat:SYN_03717
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65969"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSQ6"
FT                   /protein_id="ABW65969.1"
FT                   /translation="MAKKILIAMDESENSKRAVEFVGGNFDTRSSVTLFSVLQNTETMC
FT                   AMQAPELTPYFVAQQTSFCTLEDKKKELVAEAMEKAKKVLVKKGFAANRVDVKLVKRKK
FT                   GVARVIISEARTGKYDLVVMGKKGLSGVREFLFGSITQKVLHGVKNASVLLVD"
     atggccaaaa aaattttaat cgcaatggat gaatcggaaa actcaaaaag agcggtcgag        60
     tttgtcggcg gcaactttga caccagatcc tcggtgacac tgttcagtgt gttgcagaat       120
     acggaaacca tgtgtgccat gcaggcaccg gagctgacgc cctattttgt tgctcagcag       180
     accagtttct gtactctgga agacaagaaa aaggagctgg ttgccgaggc catggaaaaa       240
     gcaaaaaaag tgctggtaaa aaaaggcttt gccgcaaaca gggtagacgt caagctggta       300
     aaacgtaaaa aaggcgtggc ccgggttatt atcagcgagg ccaggaccgg caagtatgac       360
     ctggtggtca tgggcaaaaa ggggctgtca ggagtccggg agtttctgtt tggcagcatc       420
     acccagaaag tcctgcatgg cgtcaaaaac gcgtcggttc tgctggtcga ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page