(data stored in ACNUC7421 zone)

EMBL: CP000859.PE165

CP000859.PE165       Location/Qualifiers
FT   CDS_pept        184295..184627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0165"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: mag:amb1332
FT                   regulator of competence-specific gene"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65975"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR2"
FT                   /protein_id="ABW65975.1"
FT                   /translation="MPVSNEFLIFVLDQLAEWGGVTARKMFGGAGLYRDGRMFGLIAGD
FT                   VVYLKVDDSNREAFVRAGSSAFKPFADKPVSLSYYEVPPDVLEVPEELIDWAARSLAVQ
FT                   SRKKKK"
     gtgccggtct caaatgagtt tctcatcttt gtgctggacc agctggccga gtggggcggc        60
     gttaccgccc gcaagatgtt cggcggagcc gggctgtacc gggacggccg gatgttcgga       120
     ctgattgccg gtgacgtggt ctacctcaag gttgatgact ccaatcgcga ggcgtttgtc       180
     cgggccgggt catcggcctt caaaccgttt gccgataaac ccgtcagcct gtcctattat       240
     gaggtaccac ccgatgttct ggaggttccg gaagaactga ttgactgggc cgcccggtcg       300
     ctggctgttc agagcagaaa aaagaagaag tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page