(data stored in ACNUC7421 zone)

EMBL: CP000859.PE167

CP000859.PE167       Location/Qualifiers
FT   CDS_pept        complement(186392..187033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cac:CAC3687
FT                   transcriptional regulator, AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65977"
FT                   /db_xref="GOA:A8ZSR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR4"
FT                   /protein_id="ABW65977.1"
FT                   /translation="MTISKNKARIPVQKRSIETKEKILNAAWELFAEKGYFKTNTNELA
FT                   ERAGIATGSFYGYFNNKKEVGIELMMRFYKEVSKKALSNFYIQIGDNVAENLDTGRKLV
FT                   RFIIKSLKESHAINPLLHKETTALILLDEDVRNISSEEDKKIIAFLITLLQQHKQLIRV
FT                   DDIEAAAVLLFRTSDEIIHRIMIHKDAIDEDRLLKELEDMICSYLFITVS"
     gtgactatat caaaaaataa agctcgaata ccggtacaaa agcgcagcat cgaaaccaag        60
     gaaaaaatcc taaacgcagc ttgggagctt tttgctgaaa agggatattt taaaactaat       120
     acgaatgagt tggccgaacg agccgggata gccacgggat ccttttatgg atatttcaat       180
     aacaagaagg aagttggcat agagttaatg atgcgcttct ataaagaagt atctaaaaag       240
     gcactctcca atttttacat acagatcggc gacaacgttg cggaaaacct tgatacggga       300
     agaaagctcg ttcgatttat aattaaatct ttaaaggaat cccatgccat caatccgctg       360
     cttcacaagg aaaccacagc tttgattctt ctggatgaag atgttagaaa tatcagcagc       420
     gaagaagaca aaaagataat cgcattttta atcactctct tacaacagca taagcagtta       480
     attcgtgtgg atgatattga agccgctgcc gtcttgctgt ttaggacaag cgatgagatt       540
     atccaccgga tcatgattca taaagacgca atcgatgaag accggctgct caaagagctt       600
     gaagacatga tttgcagcta tctttttatc accgtcagtt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page