(data stored in ACNUC7421 zone)

EMBL: CP000859.PE17

CP000859.PE17        Location/Qualifiers
FT   CDS_pept        complement(18772..19362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65827"
FT                   /db_xref="GOA:A8ZRR0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR0"
FT                   /protein_id="ABW65827.1"
FT                   /translation="MDLNDLIPVLVFLAIVGFQVIGAMIKRARKPAPDGEAADTGAGPG
FT                   GVLGRVFSRIQQEMERAAREVEAKREAPSQWDLLMPEDAPPQAEKPAAPAQGMRQVHEG
FT                   RRAEAVVQPVLRKQAPPAPSPAKTMKRGTTAFETALQQAGAAPAPAALPVSKPSIVTGS
FT                   AAELRRAVVWSEILGPPVALRKTPEDRWEPDVL"
     atggacttaa acgacctgat accggttctg gtttttctgg ccatcgtggg gtttcaggtg        60
     atcggcgcga tgatcaagcg ggcgcgaaaa ccagcgcccg acggtgaagc cgccgatacc       120
     ggggccggac cggggggggt gctgggccgg gtgttttccc gcattcagca ggagatggag       180
     cgggccgcca gggaggtgga agccaaaagg gaggcccctt cccagtggga ccttctgatg       240
     ccggaagatg caccaccgca agcggaaaaa ccggcggccc cggcccaggg aatgcgacag       300
     gtccatgagg ggcgacgggc ggaagcggtt gtccagcccg tcttgcggaa acaggcgccg       360
     ccggccccgt ccccggcaaa gacgatgaaa agaggcacca ccgcctttga aaccgccctg       420
     caacaggccg gggccgctcc agcaccggcc gcccttccgg tgtcgaagcc gtccatcgtc       480
     acggggtccg cggccgagct gcgccgggcc gtggtctggt ccgagatttt gggcccgccg       540
     gtggcgttaa gaaagacccc tgaagaccgt tgggaaccgg acgttttgta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page