(data stored in ACNUC7421 zone)

EMBL: CP000859.PE171

CP000859.PE171       Location/Qualifiers
FT   CDS_pept        complement(189575..191494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0171"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pca:Pcar_0431 putative ATP-binding component of a
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65981"
FT                   /db_xref="GOA:A8ZSR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSR8"
FT                   /protein_id="ABW65981.1"
FT                   /translation="MALISMQDVRWGFGEPYLLDGISFNIEKGERVGLLGRNGVGKSSL
FT                   FRLLTREILPDSGEIVIGQGIQVAALEQEVAAGRPCPSKMSPEVKETVFEVVARGLGPA
FT                   GQNLADFYRVCSAMASSHEPRLSDERERLQHALDTGGGWVLQQQIENILSRTDLDPKRP
FT                   FADLSAGMKRRALFARSLALSPDLLLLDEPTNHMDIDSIVWMESFLLRHVKTLLFITHD
FT                   RVFLERIATRIMVLDRGRLFSYACDYKTYLQRREAELAAEAEHQRNFDKKLSKEEAWIR
FT                   QGIKARRTRNEGRVRALQEMRAKVRQRRAKTGQVRLALQEAERTGKLVVQAEGLTYAYD
FT                   QTPIVQNFSTTILRGDKVGIIGPNGVGKTTLIRLLLGALAPDSGTVRHGTHLEPAYFDQ
FT                   LRTQLDEQKTVVQNISMDNDFIVFNGQKRHVIGYLQDFLFSPERCRTPVHVLSGGERNR
FT                   LLLAKLFIRPANLLVLDEPTNDLDAETLELLEELLFSYDGTLLLVSHDRSFLNHIVTST
FT                   LVFEGNGQVVEYAGGYDDWLAQRPQPVAPEAAVPKQAQPPRQAPPAKPKKLTFAQNREL
FT                   KELPAMIEALETEQRLLQAAMADPAFYRQAKEEIKARQKRLQEVEDKISACYRRWEELE
FT                   DLTP"
     atggctctca tcagtatgca ggatgtccgc tggggtttcg gcgaaccgta ccttctggac        60
     ggcatcagct ttaatattga aaaaggggaa cgggtcgggc ttttggggcg caacggcgtt       120
     ggaaagtcga gcctgttccg gttgctgacc cgggaaatcc tgccggacag cggggaaatc       180
     gtcatcggcc aggggattca ggtggccgcc ctggagcagg aggttgcagc ggggagaccg       240
     tgtccttcca aaatgtcccc ggaagtcaaa gaaaccgttt ttgaagtggt ggcccgcggc       300
     ctgggccctg ccggacaaaa cctggccgac ttttaccggg tgtgttccgc catggcgtcc       360
     tcacatgaac cgcgcctttc cgacgaacgg gagcgtttac agcatgcgct ggacaccggg       420
     ggcggatggg tgctgcaaca acagatcgaa aacattcttt cgcggaccga tcttgatccc       480
     aaaaggcctt ttgccgatct gtcggcgggc atgaaacggc gggccctgtt tgcccggtcc       540
     ctggccctgt cgcccgacct tctgctgctg gatgaaccga ccaaccacat ggatatcgac       600
     agcattgtct ggatggaatc gtttctcctg cgccatgtca aaacccttct gtttattacc       660
     catgaccgtg tttttttaga acggatcgcc acccggatta tggtcctgga ccgtggccgg       720
     ctgttttcct atgcctgcga ctacaagacc tacctgcagc gccgcgaggc ggagctggcg       780
     gcagaagccg agcaccagcg caatttcgac aaaaaactct caaaggagga ggcctggatc       840
     cggcagggca tcaaggcccg gcgcacccgc aacgaaggcc gggtgcgcgc gttacaggag       900
     atgcgggcca aagttcgcca gcgccgcgcc aaaacaggcc aggtgcgcct ggcgctgcag       960
     gaggccgaac gcaccggcaa gctggtggtc caggcggagg gactgacgta tgcctacgac      1020
     cagacgccca ttgtgcaaaa tttttccacc accatcctgc gcggtgacaa ggtcggcatt      1080
     atcggcccca acggcgtggg caaaaccaca ctgatccggc tgctgctggg cgcccttgca      1140
     ccggacagcg gcacggtccg ccacggcaca cacctggagc cggcctattt cgaccagctc      1200
     cggacccaac tggatgagca gaaaacggtt gtgcagaaca tttccatgga caatgatttt      1260
     atcgtgttta acggccagaa gcggcacgtg atcggttatc tccaggattt tctgttttcg      1320
     cccgagcggt gccgcacccc ggttcacgta ctttccggcg gagagcgcaa ccggctgctg      1380
     ctggccaaac tctttatccg cccggccaat ctgctggtgt tagacgagcc gaccaatgac      1440
     ctggatgccg agaccctgga attattagaa gaactgttgt tttcctatga cggcaccctg      1500
     ctgctggtca gccatgaccg aagcttttta aaccatatcg tgaccagcac gctggttttt      1560
     gaaggcaacg ggcaagtggt tgaatatgcc ggcggatacg atgactggct ggcccagcgc      1620
     ccccaaccgg tcgccccgga agcggccgtg ccaaaacagg cgcaaccccc caggcaggcc      1680
     cccccggcca aacccaaaaa gctgaccttt gcccagaacc gggagcttaa agagctgccg      1740
     gccatgatcg aagccctgga aaccgaacag cgccttctcc aggccgccat ggctgaccct      1800
     gctttctaca ggcaggcaaa agaagagatc aaggcccggc aaaaacgcct tcaggaagtc      1860
     gaagacaaaa tcagcgcctg ttaccgccgc tgggaagaac tggaagatct aacgccatag      1920
//

If you have problems or comments...

PBIL Back to PBIL home page