(data stored in ACNUC7421 zone)

EMBL: CP000859.PE173

CP000859.PE173       Location/Qualifiers
FT   CDS_pept        complement(192500..193378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0173"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: swo:Swol_0919 oxygen-independent
FT                   coproporphyrinogen III oxidase, Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65983"
FT                   /db_xref="GOA:A8ZSS0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS0"
FT                   /protein_id="ABW65983.1"
FT                   /translation="MRYEGQIYRPFSEANSYLLQCTVGCSHNGCTFCGMYKDRRFRVRS
FT                   TDEILEDIRMAGNHYGDVEKVFLCDGDAVCMETETLLAILKALYDTFASLRHVGTYVGP
FT                   QSTLEKSMADLARLRGAGLTKAYLGVESGDDAVLTDINKGVTAAQMLEAGRRLVEAGFN
FT                   LSSMVLLGIAGTGEPARRHAALTADITNRMKPRYLAALTYTPVPHTALFKKVESGKFVL
FT                   PDPFETLEEMKVMFENITIDNLTFVGAHASNYLPVSGKLQKDKAAMLQTVNAVLTSRNM
FT                   NALRPDAMRGL"
     atgcggtacg aaggacagat ttacaggccc ttttccgagg cgaacagtta tcttttacaa        60
     tgcaccgtcg gatgctcgca caatgggtgc accttttgcg gcatgtacaa ggaccgccgg       120
     ttccgggtcc ggtctacgga tgagatttta gaagatattc gcatggccgg gaatcattac       180
     ggagatgtgg aaaaagtctt tttgtgcgac ggggacgcgg tgtgcatgga gaccgaaacc       240
     ctgctggcca ttttaaaggc gctgtacgac acctttgcct cccttcgcca cgtgggcacc       300
     tatgtgggcc cccagagcac tttggaaaaa agcatggccg accttgcgcg cctgaggggc       360
     gcgggcctga ccaaggcgta cctgggagtg gagtccggtg atgacgcggt gctgacggat       420
     atcaacaagg gagtaaccgc agcccagatg ctggaggcgg gcagacggct ggtggaggcc       480
     ggcttcaacc tgtcgtccat ggtgctgctg ggtattgcag gaacagggga gccggccaga       540
     aggcacgcgg cccttaccgc tgatatcacc aaccggatga agccccggta cctggcggcc       600
     ctgacctata ccccggtgcc ccacaccgcc ctgtttaaaa aagtcgaatc cggaaaattt       660
     gtgctgcccg atccttttga aacattagaa gagatgaagg tgatgtttga aaacatcacc       720
     atcgacaacc tgacctttgt cggcgcccat gcctccaatt acctgcctgt cagcggaaaa       780
     ctccagaaag acaaggccgc catgcttcag accgtcaatg ccgtgctcac atcccggaac       840
     atgaacgcgc tgcggccgga tgccatgcgg gggctgtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page