(data stored in ACNUC7421 zone)

EMBL: CP000859.PE178

CP000859.PE178       Location/Qualifiers
FT   CDS_pept        197194..198024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0178"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   afu:AF1313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65988"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS5"
FT                   /protein_id="ABW65988.1"
FT                   /translation="MTLTDFQQLGKELYEKLHLPTYPVAITYIKSEDEIPAKAMRPSAM
FT                   GQKMCICQTFTYARSWGAHVAITAEENFCVPGSAGHKWVDVTDEEFIESQVTQGWHKSR
FT                   EAEINRINGYNMLFAGPEGQARLARAKARIGLVASPLHQALMVPDTVLVFGNGVHITHI
FT                   IQALCYDYKAPIMSVFEGFGESCMMGGMIPFLTGQPQIVIPGMGDRAFAGITPDEIGIG
FT                   IPAAKFPVVLEDLFKTGGPMNIGMPFKTMIPTNLTEDITPGFAYLKKIVDEKSR"
     atgaccctga ccgactttca acaactggga aaagaattat acgaaaaact ccatctgccc        60
     acctatcccg tggccatcac ctacatcaaa agcgaggatg aaattcccgc caaggccatg       120
     cggccctcgg ccatgggcca gaagatgtgc atctgccaga cctttaccta tgcccgctcc       180
     tggggcgccc atgtggccat cacggctgag gaaaatttct gtgttcccgg ttcagccggg       240
     cataaatggg tggatgtgac cgacgaggag tttatcgaaa gccaggtcac ccagggctgg       300
     cataaaagcc gggaagcgga aatcaaccgc atcaacggct acaacatgct gtttgccgga       360
     ccggagggcc aggcccggct ggccagggca aaagcacgga tcggtctggt ggcctccccc       420
     ctgcaccagg ccctgatggt gccggacacg gtgctggtat tcggcaacgg ggtgcatatc       480
     acgcacatca ttcaggccct ctgttacgac tacaaggccc cgatcatgtc cgtgtttgaa       540
     gggttcggcg aatcctgcat gatggggggc atgattccgt ttttgaccgg acagccccag       600
     atcgtcattc ccggtatggg ggaccgggcc tttgccggca tcacaccgga tgagatcggc       660
     atcggcattc ctgcggcaaa gtttccggtc gtcctggaag acctgtttaa aaccggcggt       720
     cccatgaaca tcggcatgcc gtttaaaacc atgattccca ccaacctgac cgaggacatc       780
     acaccgggtt ttgcgtatct gaaaaaaatc gtggacgaaa aaagccgata g                831
//

If you have problems or comments...

PBIL Back to PBIL home page