(data stored in ACNUC7421 zone)

EMBL: CP000859.PE179

CP000859.PE179       Location/Qualifiers
FT   CDS_pept        198054..198575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65989"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSS6"
FT                   /protein_id="ABW65989.1"
FT                   /translation="MAASREQVLETAFNAAKQYEMKSGGCPQCTLAGIFDALEVQNDDV
FT                   FRAATGLADGVGLTGEGHCGAISGGVLAIGYLFGRKKKDFGDMFKLVEANLLSKKLLDR
FT                   FMEKYGTCRCADLQTAFFGRFFNLLDPNDLNAAMEAGMLERCSTLAGEVARMTTEIILE
FT                   AREKKELSTK"
     atggcagcat caagagagca ggtcctggaa accgccttta acgcggccaa gcagtatgag        60
     atgaaaagcg gcgggtgtcc ccaatgtaca ctggccggta tttttgacgc ccttgaggtt       120
     caaaacgatg atgttttcag ggccgccaca ggcctggccg acggagtcgg cctgaccgga       180
     gaaggccact gcggagcgat ctccggcggc gtcctggcca tcggctatct ttttggcagg       240
     aagaaaaaag atttcggcga catgttcaag ctggtggaag ccaacctgct ttccaaaaaa       300
     ctgctggacc ggtttatgga aaaatacggc acctgcagat gcgctgattt gcagaccgcg       360
     tttttcggcc ggttcttcaa tctgcttgac ccgaatgatc tgaatgccgc catggaagcg       420
     ggcatgctgg agaggtgctc cacgctggcc ggagaagtgg cccgcatgac cacggagatc       480
     atccttgaag cgcgggaaaa aaaggaatta tccaccaaat ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page