(data stored in ACNUC7421 zone)

EMBL: CP000859.PE184

CP000859.PE184       Location/Qualifiers
FT   CDS_pept        202839..203846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0184"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sfu:Sfum_3459
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65994"
FT                   /db_xref="GOA:A8ZST1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST1"
FT                   /protein_id="ABW65994.1"
FT                   /translation="MSKKNVILEKSGGRKFDLYAEVGKYFSSAGQLDEIAFKQALHEKL
FT                   KALKDGNPPDGFIQPATEWLSGYLNEILNYLREKGISEPALKLFKIAINESSLYGLENI
FT                   SVSVDCLQHIVSELPEPQKTPVEKKGAADEMRQRIFAAAIDVFAEDGFHRATIDKVSET
FT                   AGIGKGSVYRHFKSKEEILDELLRKAFQEVVERISTITSKDIDILQMVQEMIESWILFI
FT                   SNNHKLYRIIQTQAMYGQTGRTVMFYDYVISRLPLFKERLVSLNRDKELKTTNLYTVFY
FT                   GIMGFIDGVVQKWFRCGMDYSLIDEVPVILEVLFNGFVGEKTTRTVFFIPPEKD"
     atgagcaaaa aaaacgtcat tcttgaaaag tccggcggcc gtaagtttga cctgtacgct        60
     gaagttggaa aatacttttc atctgccgga cagcttgatg aaatcgcatt caagcaggcg       120
     cttcatgaaa aattaaaagc gctgaaggac ggcaacccac cggatggctt tattcaaccg       180
     gccacagagt ggctgtcggg ttaccttaac gagatcctta actatcttag agagaagggc       240
     atttccgaac ccgcactgaa gctctttaaa atcgccataa acgaatcctc cctgtatggc       300
     cttgaaaaca tttccgtatc tgttgactgc ctgcagcata ttgtcagtga actcccggaa       360
     ccgcagaaaa caccggtaga aaagaagggg gcggccgatg aaatgcggca gcggattttc       420
     gcggcggcca ttgatgtgtt tgctgaagac gggtttcacc gggccacaat agataaagtc       480
     tcggaaaccg cgggaatagg caaagggtct gtttaccgcc attttaaaag caaagaagag       540
     atccttgacg aactgctccg aaaagcattt caggaagttg tagagcgtat cagcacaatc       600
     acatcaaagg atattgatat ccttcagatg gtgcaggaaa tgatcgagtc gtggatactt       660
     tttatttcca ataaccacaa gctctacaga atcattcaga cgcaagccat gtacggccag       720
     accggcagaa ccgtcatgtt ttatgattat gtgatatccc gcctgccgct ttttaaagag       780
     cggctggtct ccctcaatcg ggacaaagag ctgaaaacaa caaacctgta cacggttttc       840
     tatgggatca tggggttcat tgacggtgtt gttcagaaat ggtttcgatg cggcatggac       900
     tactccctga tcgatgaggt acccgtaatc ctggaagtcc ttttcaacgg gtttgtcggt       960
     gaaaaaacca cccgtacagt ctttttcatc ccgccggaaa aggattag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page