(data stored in ACNUC7421 zone)

EMBL: CP000859.PE185

CP000859.PE185       Location/Qualifiers
FT   CDS_pept        203920..204675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0185"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01176 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65995"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST2"
FT                   /protein_id="ABW65995.1"
FT                   /translation="MKINATLFELFEKKAKKTTVTHLCMGLGYTVVTTSDGGIGIAYTF
FT                   FENKTACTVQKSYENPEGAPAIGLVEHILSDSPILRTQALAAINALNYSAAASLAQGPD
FT                   NADLLAQMGVEKGTHVAMVGAFKPLIKVIREKEAELSLMDAGKGIGDEQDFYEKLGTWA
FT                   DVLILTATTLLNNTTEAVLGHAGPGVRTVLLGPSTPLVKEAFAGLPVDFLAGTVPMDAQ
FT                   GTIQAIRHGTGTPVIQRFGRKVVMAMGEG"
     atgaagatca acgcaacgct gtttgagctg tttgaaaaga aggcaaagaa gaccaccgtc        60
     acccatctgt gcatgggcct gggctatacg gtggtaacca cgtcagacgg cggcatcggt       120
     attgcctata ccttttttga aaacaagacc gcctgcacgg ttcaaaaaag ttatgaaaac       180
     ccggaggggg cgcctgccat cggcctggtg gaacatattc tgtccgacag cccgattctg       240
     cgcacccagg ccctggccgc catcaatgcg ttaaattaca gcgctgccgc ttccctggcg       300
     caggggccgg acaacgcgga cctgctggcc cagatgggcg tggaaaaggg aacacatgtg       360
     gccatggtgg gggcctttaa acccctgatc aaggtgattc gggaaaaaga ggccgaactg       420
     tcgctgatgg acgcgggcaa gggaatcggt gatgaacagg acttttatga aaagctgggt       480
     acctgggccg atgtgctgat tcttaccgcc accacgctgc tgaacaacac aacggaagcc       540
     gttctcggcc atgcgggccc aggcgtgcgt accgtgctgc tgggacccag cacccccctg       600
     gtcaaagagg cgtttgccgg cctgcctgtt gattttttgg caggcaccgt tccgatggat       660
     gcgcagggta cgattcaggc cattcgccac ggcacaggca cgccggtgat tcagaggttt       720
     ggcagaaaag tggtgatggc gatgggggag ggatag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page