(data stored in ACNUC7421 zone)

EMBL: CP000859.PE188

CP000859.PE188       Location/Qualifiers
FT   CDS_pept        207128..207331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0188"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: dps:DP2621 similar to sec-independent
FT                   protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65998"
FT                   /db_xref="GOA:A8ZST5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST5"
FT                   /protein_id="ABW65998.1"
FT                   /translation="MFGLGMPELVIILVIALIVFGGRKLPELGSGLGSAIQNFKKSVSE
FT                   VKHEGKTALEEGKKEKEATPSA"
     atgtttggac tgggtatgcc ggagctggtt atcattcttg tgattgcgct gatcgtgttc        60
     ggcggacgca agctgccgga gctggggtcc ggcctgggca gcgcgataca gaactttaaa       120
     aaatcggttt ccgaggtaaa acacgaagga aagaccgccc tggaggaggg caaaaaagag       180
     aaagaggcca ccccgtccgc ataa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page