(data stored in ACNUC7421 zone)

EMBL: CP000859.PE189

CP000859.PE189       Location/Qualifiers
FT   CDS_pept        complement(207371..208126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0189"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: pth:PTH_2704
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65999"
FT                   /db_xref="GOA:A8ZST6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST6"
FT                   /protein_id="ABW65999.1"
FT                   /translation="MEKKTKQPAAKTPPAPLSMTGLAKASGVSPKTVRTYIDAGLLPPP
FT                   EKKRGTTAYYDARCVNMINMIDRFHSKYSLPLPIIRQVIDEIGHEKALEESGELTKKLN
FT                   RAKKMPWFEHIVDANSKPFLTKKALILATGLSPKDLDKAIAQKLIMPDKNGLFCKNDMD
FT                   LALLLSQLKGTGAGKEKILLDFLNMQLQMTESLVEKEFNAFFKNIINKNITVEDANELA
FT                   EKAIDVLTTLLPLCYRQLLNRKIEELRKT"
     atggaaaaaa agacaaaaca gcctgctgcc aaaacaccgc cggctcccct ctcaatgacc        60
     ggccttgcca aagcgtccgg agtgtcgccc aaaaccgtgc ggacttatat tgatgccggc       120
     ctgctgccgc cacctgaaaa aaagcggggc accaccgcct actacgacgc ccggtgtgtc       180
     aacatgatca acatgattga ccggtttcac agcaaatatt cccttccact tcccatcatt       240
     cggcaggtga tagatgaaat cggccatgaa aaagcgcttg aggagagcgg tgaactcacg       300
     aaaaaactca accgggccaa aaaaatgcca tggtttgaac acatcgtgga cgcgaacagc       360
     aagccgtttc tcaccaaaaa ggccctgatc ctggccaccg gtctctctcc aaaagacctg       420
     gacaaggcca tcgcgcaaaa actgattatg ccggataaaa acggcctgtt ctgcaaaaac       480
     gacatggacc tggccctgct gctgtctcaa ctgaagggaa cgggcgcggg aaaggaaaag       540
     attctgctcg actttctgaa catgcagctt cagatgaccg agtccctggt ggaaaaagag       600
     tttaacgcgt ttttcaaaaa cattatcaac aagaacatca ccgtggaaga cgccaatgaa       660
     ctggcggaaa aggccattga cgtgctgacc acgctgctgc ccctctgcta ccgccagctg       720
     ttgaaccgga aaatagaaga actgcgcaaa acctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page