(data stored in ACNUC7421 zone)

EMBL: CP000859.PE190

CP000859.PE190       Location/Qualifiers
FT   CDS_pept        complement(208138..208707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0190"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: sat:SYN_00638 tungsten formylmethanofuran
FT                   dehydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66000"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZST7"
FT                   /protein_id="ABW66000.1"
FT                   /translation="MICGRTPDELIRDIEGFHGFVAPGLVIGAFMVDLAREHIGQNTEA
FT                   DAVVETRHCLPDAVQILTPCTVGNGWLKIADLDKFALTLYDRHTFAGFRVWLDLNKAKA
FT                   HPNVYNWFMGLVSKKDLPKEILIPAIFDAGRDILSVKPVTVRAEFAKREKKSKIAVCPA
FT                   CNEAYAAAQGTPCLACQGKDYYHTGS"
     atgatttgcg ggagaacccc ggacgaactg attcgggaca ttgagggctt tcatggtttt        60
     gtggcgccgg gcctggtgat cggggccttt atggtggacc tggcccggga gcacatcggc       120
     caaaacaccg aggccgacgc cgtggtggaa acccgtcact gcctgcccga cgccgtgcag       180
     attctcaccc cctgcaccgt gggcaacggc tggctcaaaa tcgccgacct tgacaagttt       240
     gccctcactt tatatgatcg ccacactttt gccggtttca gggtatggct ggacctgaac       300
     aaggccaaag cccaccccaa tgtctataac tggtttatgg gacttgtgtc caaaaaggac       360
     ctgcccaaag agatcctgat tccggccatc tttgacgccg gacgggatat tctctccgtt       420
     aaacccgtca ccgtgcgggc cgaatttgca aaacgggaga aaaaaagcaa aatcgcggtc       480
     tgccccgcct gcaacgaggc ctatgccgcg gcccagggca cgccctgcct ggcctgccag       540
     ggcaaggact attaccacac aggttcatag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page