(data stored in ACNUC7421 zone)

EMBL: CP000859.PE2

CP000859.PE2         Location/Qualifiers
FT   CDS_pept        1624..3012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0002"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sfu:Sfum_0534 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65812"
FT                   /db_xref="GOA:A8ZRP5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP5"
FT                   /protein_id="ABW65812.1"
FT                   /translation="MAPLTKKTIEEIQGIVGSDHCTTAPEDRVCYAYDASAADCLPDAV
FT                   VFPADRDQVARVLALAHRDGFCVTPRGSGSGMTGGSVPVAGGVVMVLNRLNRILEIDTD
FT                   NLVARVEPGVITGDFHKAVEALGLFYPPDPSSAAFSTLGGNVAECAGGPRAVKYGVTRD
FT                   YVLGLSAVLPNGDIITTGVRTAKGVAGYDLTRLIAGSEGTLAVITEMTLRLLPLPEAVG
FT                   TMTALFDDIRQAARTVSEIIRQRIVPRTLEFIDNASLGCVEKSLNLGLPITAAAMLLIE
FT                   VDGAPLANTAALEKIAAICTSQGATQVTVADTKQAAEDLWRARKAISPALFNLAPDKIN
FT                   EDIVVPRSRIPDMVAALEALSRQTGLTIACFGHAGDGNIHVNIMADKKDPVQAERAKEA
FT                   TDRLFEETLRLGGTISGEHGIGITKAPYLGKEVGGAELMLMRRIKKVFDPNGILNPGKI
FT                   FHLI"
     atggcccccc tgacgaaaaa gacaatcgaa gagattcagg gcatcgtggg aagcgaccac        60
     tgcaccacgg cccctgaaga ccgggtctgc tacgcctacg acgcatccgc cgccgactgc       120
     ctgcccgatg ccgtggtgtt tcccgcggac cgggaccagg tggcccgggt gctggccctg       180
     gcgcacaggg atgggttttg tgtcactccc cggggatcgg gatcaggcat gaccggcggg       240
     tcggtaccgg tggccggggg cgtggtcatg gtgttaaacc ggctcaaccg gattctggag       300
     atcgacacgg acaacctggt ggctcgcgtt gagccggggg tgatcaccgg cgactttcac       360
     aaggccgtgg aggcactggg ccttttttat ccgcccgatc cctccagcgc cgccttttcc       420
     accctgggcg gcaacgtggc cgagtgcgcg ggcggccccc gggccgtcaa atatggagtg       480
     acacgggatt atgttctggg gttgtcagca gtgctgccca acggcgatat tattaccacc       540
     ggcgttcgca cggccaaggg ggtggccggc tacgacctga cccggctgat tgccggttcc       600
     gaaggcaccc tggccgtgat tactgaaatg accctgcggc tgttgcccct gcccgaggca       660
     gtgggcacca tgacggccct gtttgacgac atccggcagg cggcgcgcac cgtgtctgaa       720
     attattcggc aacggatcgt gccgcgcacc ctggagttta tagacaacgc ctcccttggc       780
     tgcgtggaaa aaagcctgaa tctggggttg ccgataacgg cggcggccat gctgctgatc       840
     gaggtggacg gcgcgccttt ggccaatacc gcggcccttg aaaaaattgc cgccatctgc       900
     accagtcagg gcgccaccca ggtgacggtg gccgacacga aacaggccgc cgaagacctg       960
     tggcgggccc gcaaggccat ctcccccgcc cttttcaacc tggccccgga caagatcaat      1020
     gaagatatcg tggtgccccg cagccggatt cccgacatgg tggcggccct ggaggccctg      1080
     agccggcaaa ccggcctgac catcgcctgc ttcggccatg ccggcgacgg caacattcac      1140
     gtgaatatca tggccgacaa aaaagatccg gtgcaggcgg agagggcaaa agaggcgaca      1200
     gaccggcttt ttgaagagac attgcgcctg ggcggcacga tttccggcga gcacggcatc      1260
     ggcatcacca aggcccccta cctgggaaaa gaggtgggcg gagcggagct gatgctgatg      1320
     cggcgaataa aaaaggtgtt tgaccccaac ggaattttaa atcccggaaa aatctttcac      1380
     ctgatttga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page