(data stored in ACNUC7421 zone)

EMBL: CP000859.PE201

CP000859.PE201       Location/Qualifiers
FT   CDS_pept        220159..222813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0201"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   gsu:GSU2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66011"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSU8"
FT                   /protein_id="ABW66011.1"
FT                   /translation="MFFRAHISASVVRLTAVVLFMVMFLPACSLYRVTHLDKYENFAEI
FT                   SNTLWAKLYFVFKDVDLPGYDAIIYADTRWRVSDSPVVIDKNTFILPGVYLTIDPGVEV
FT                   RLAKDILVTNRGVIVARGTPEAPIRFTWQTEGENWNAIENLNCVGRTGKSSEVVYEHCI
FT                   IEHGQGLAINSSLGRVESCVFRHNIDSALKFQYAEGAILNSTFYQNSSERQAESGNGAA
FT                   INVYSDKSVRVENNDVYDNYSHGGRDGGGGIYAFAYNDGVVEVVNNRVRNNRSDRKAGG
FT                   IFAYAARVSSNTVIDNEAAMTGGGIHVIEGGLEKNVIAGNRAPNGGGIYSEAGRLKGNL
FT                   VRANQSDNGAGLYHLGGGEILGNTFVENTCTGKETCATITLSGSPVISRNNILARTGYA
FT                   LSFKSHSLSPDLKAHENYWGTTDKQAVEQLVSDWLEDSRVGLVNWNAYLSAPAPDACPI
FT                   PENADTTVLVDVPSMPANAIRGLVEADTLLGKDGIRSYSVVGNLLVLDGNTLTLAPGTT
FT                   LKLNPDVTIRVRGTLNAEGTAKQPVRFTGDRKTPWGQLFFENRSTGPAQTEDETTRPPD
FT                   SRLRHCIVENGGGIMMDGHGADLYDCVVRNHRGTGARIKEVSVSVKNCDIYGNVSDSDG
FT                   GGLYVYGSRTVFIEGNRIADNRAADGGGIFAYGYQSNAAVDIRNNRIEGNISEGDGGGV
FT                   WMSRSALVNNLIIRNKTEAKGGGLYAGFALIEDNRISENRAAEGGGVFAEANCSFKRNV
FT                   ISHNTATSPRGGGVYLNYWGLSQHNKEFLGNRVENNTAAGARPTGGVMMNGQMDFRQNS
FT                   LTGNNGIQLYNLNAADVKDIVAPSCYWGTVSEKAVDGLIYDGKDNDRLSVVDFRPLAKT
FT                   REAAITNAESKPE"
     atgtttttcc gcgctcacat atctgcttcg gtggtccggc tgacggccgt tgttcttttt        60
     atggtgatgt tccttcccgc ctgttcgctc taccgggtga cccacctgga caagtatgaa       120
     aattttgccg agatatccaa tacgttatgg gcaaagctct attttgtttt caaagacgtg       180
     gacctgccgg ggtatgacgc gattatttac gccgataccc ggtggcgggt ctcggacagc       240
     ccggtggtga tcgataaaaa cacctttatt ctgcccggtg tttacctgac catcgatccc       300
     ggagttgaag tgcggctggc caaggatatt ctggtgacca accggggggt gattgtggcc       360
     agaggcacgc cggaggcccc catccggttc acatggcaga ccgaagggga aaactggaac       420
     gccattgaga accttaactg tgtcggcaga accggcaaat ccagtgaggt ggtatacgag       480
     cactgcatca ttgagcatgg ccagggtctt gccatcaact ccagcctggg cagggttgag       540
     tcctgcgtgt tccgtcacaa catcgattcg gccttaaagt tccagtacgc cgaaggggcg       600
     attctgaaca gcacgtttta tcagaactcc tcggagcgcc aggccgaatc gggcaacggg       660
     gccgccatca acgtgtacag cgacaagtca gtgcgggtgg aaaacaacga cgtctacgac       720
     aattactccc acggcggccg ggacggcggc ggcggtattt acgcctttgc ctacaacgat       780
     ggtgtggtgg aggtggtcaa taaccgggtc cggaacaatc gcagcgaccg aaaggccggc       840
     ggtattttcg cctatgcggc ccgggtgagc agcaacacgg tgattgataa cgaggctgcc       900
     atgaccggcg gcggcattca cgtcattgag ggggggctcg agaaaaacgt gattgccggc       960
     aatcgcgcgc ccaacggtgg gggcatctat tccgaggccg gtcggctgaa ggggaacctg      1020
     gtgcgggcca accagtccga caacggcgcc ggcctttatc acctgggcgg cggcgagatt      1080
     ctgggcaata cctttgtgga aaacacctgc accggaaaag aaacatgcgc caccatcacc      1140
     ctgtccggca gcccggtgat ttcccgcaac aacattctcg cccgcaccgg gtatgcgctt      1200
     tccttcaagt cccacagcct ttcaccggac ttaaaggccc atgaaaacta ctggggcaca      1260
     acggacaaac aggccgttga acagctggta agtgactggc tggaagacag ccgggtgggg      1320
     ctggtgaact ggaacgccta tctgtcggca ccagcgccgg acgcctgtcc cattcccgaa      1380
     aatgccgaca caacggtatt ggttgatgtg ccttcaatgc cggccaacgc gatacggggg      1440
     ctggtggaag cagataccct gctgggtaaa gatggtatcc ggtcctactc ggtcgtcggc      1500
     aacctgctgg tgctggacgg gaacaccctg actctggcgc cgggcaccac gctgaaactg      1560
     aatccggatg ttaccattcg cgtgagaggt accctgaacg ccgaaggtac ggcaaaacag      1620
     ccggtccgct ttaccggaga ccggaaaacg ccctggggcc agctcttttt tgaaaacaga      1680
     agtaccggac cggcccagac agaagacgaa accacccgcc cgccggacag ccgcctgcgc      1740
     cactgcattg tcgagaacgg tggcggcatc atgatggacg gtcacggcgc ggacctgtat      1800
     gactgcgtgg taagaaacca caggggcacc ggcgcccgga tcaaggaggt gtcggtatcg      1860
     gtcaagaact gcgatattta cggtaatgtc agcgattccg acggcggagg tctttacgtt      1920
     tacggcagcc ggaccgtctt tatcgagggc aaccggattg ccgacaaccg ggccgccgac      1980
     ggcgggggca tctttgccta cggctaccag tccaacgccg ccgtggatat tcgcaacaac      2040
     cggatcgaag gcaacatcag cgagggggac ggcggcgggg tctggatgtc ccggtccgcg      2100
     ctggtgaaca acctgatcat tcgtaacaaa acagaggcca agggcggtgg cctgtatgcc      2160
     ggatttgccc tgatcgagga caaccggata tcggaaaatc gtgcggccga ggggggcggg      2220
     gtgtttgcag aggccaactg ctccttcaag cggaatgtaa tttcccacaa caccgccacc      2280
     agccccaggg gcgggggcgt ttatctcaac tactggggcc tgagccagca caacaaggag      2340
     tttctgggca accgggtgga aaacaacacg gccgccgggg ccagacccac gggcggagtg      2400
     atgatgaacg ggcagatgga tttccgtcag aacagcctca ccggcaacaa cggtattcag      2460
     ctttacaatc ttaacgcggc tgacgtgaag gacattgtcg ccccgtcgtg ctactgggga      2520
     accgtgtcgg aaaaggccgt tgacggttta atttacgacg gcaaggataa tgaccggctg      2580
     tccgttgtcg atttccggcc ccttgcgaaa accagagagg ccgccatcac aaacgcggaa      2640
     agcaaaccgg agtag                                                       2655
//

If you have problems or comments...

PBIL Back to PBIL home page