(data stored in ACNUC7421 zone)

EMBL: CP000859.PE203

CP000859.PE203       Location/Qualifiers
FT   CDS_pept        224226..225737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0203"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   csc:Csac_1797 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66013"
FT                   /db_xref="GOA:A8ZSV0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV0"
FT                   /protein_id="ABW66013.1"
FT                   /translation="MISRSQTKALLEREPKFDDMMGSLRATGKQPKGVIGEVRKLMAVA
FT                   RRFNDSYTSGYWRELDLKMHEDPDYLPWEVVKKANELNFYSLFIPKIFGGKGYSISGIG
FT                   PFLEEIGSVCASVANLIGVHYLGFVGLAASWNMRLTDMVCREVVNGEKTGEPCLMSFAM
FT                   TEPDAGTDSQNVEFMDTGSLACHAEKVEGGYKVNGTKIFISCGHLSTWHILFAYTDPAK
FT                   GSESMVMMAVKNGTKGFSFGKKEKKMGQKASLASELVFKDCFVPDDMVLLDKTQSAGLS
FT                   RSPRDITELILANIWAASRVGVAAFGSSAAKGAFEQALRFASETEVDGRPLVTHEWCQA
FT                   MLAEMYKNAAVARMAYSEGAYINGMDGMVKMLNIKPLYYMMKYTPVSLLDPIMKPINKM
FT                   GFTTWISRKIAFDWVDDAAVDRTDGWGSLVKFTATDMGMQNGRMALELMGGAGVRHSEH
FT                   AEKILRDAKLFQIYEGTNQINRINVFKRLVARTCPGTECFCSANL"
     atgatttccc gctcacagac aaaggcgctt ctggaaagag aaccgaagtt tgacgacatg        60
     atgggcagcc ttcgggccac cggaaagcag cccaaggggg tcatcggtga agttcgaaaa       120
     ctgatggccg ttgcccgccg gttcaacgat tcatatacct caggctactg gcgggagctg       180
     gacctgaaga tgcatgagga tccggattac ctgccgtggg aggtggtgaa aaaggccaat       240
     gagctcaatt tctattctct ttttattccc aagattttcg gcggaaaagg ctacagcatt       300
     tcgggcatcg ggcctttctt agaagagatc gggtcggtgt gcgcctcggt ggccaatctg       360
     atcggcgtgc actacctggg cttcgtgggg ctggccgcct cctggaacat gcgcctgacc       420
     gacatggtct gccgggaggt tgtcaacggt gaaaagaccg gcgagccctg tctcatgtcg       480
     tttgccatga ccgagccgga cgccggcacc gactcccaga acgtagagtt catggatacc       540
     ggctcccttg cctgccacgc ggaaaaggtg gagggcggtt acaaggtcaa cggcaccaag       600
     atctttatca gctgcggaca cctttccacc tggcacattc tgtttgccta caccgatccg       660
     gcaaagggat cggaaagcat ggtgatgatg gcggtgaaaa acggcaccaa gggattttcc       720
     ttcggcaaga aggaaaagaa gatgggccag aaggcatccc tggccagtga actggtgttc       780
     aaggactgtt ttgtccccga cgacatggtg ctgctggaca aaacgcagtc cgccggtctt       840
     tcccggtctc cccgggacat caccgagctt attctggcca acatctgggc cgcctcccgg       900
     gtgggtgtgg ccgcctttgg ctcgagcgcg gccaaggggg cctttgagca ggccctgcgg       960
     tttgcatcag agaccgaggt ggacggcagg cccctggtca cccacgagtg gtgccaggcc      1020
     atgctggccg agatgtacaa aaacgcggcc gtggcccgaa tggcttacag tgagggggcc      1080
     tatatcaacg gtatggacgg catggtaaag atgttgaaca taaagccgtt gtactacatg      1140
     atgaaataca cgcccgtttc cctgcttgat cccatcatga agccgatcaa taaaatgggg      1200
     tttaccacct ggatatcaag aaaaatcgct tttgactggg tggacgacgc cgccgttgac      1260
     cgcacggacg gctgggggtc tcttgtcaag ttcacggcca cggacatggg tatgcagaat      1320
     ggccgcatgg ccctggaact gatggggggc gccggcgtgc gccacagcga acatgccgag      1380
     aaaatactgc gggacgccaa gctgttccag atttacgagg gcaccaacca gatcaaccgg      1440
     atcaacgtgt tcaagcgact ggtggcgcgc acctgccccg gcaccgaatg cttttgcagc      1500
     gcaaatcttt aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page