(data stored in ACNUC7421 zone)

EMBL: CP000859.PE206

CP000859.PE206       Location/Qualifiers
FT   CDS_pept        229297..229776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0206"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: dar:Daro_1782
FT                   molybdopterin-guanine dinucleotide biosynthesis MobB
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66016"
FT                   /db_xref="GOA:A8ZRZ8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ8"
FT                   /protein_id="ABW66016.1"
FT                   /translation="MKIFHIVGRSKNGKTTLILELIAELRKRGLAVGTLKHSGHAHELE
FT                   TPGKDSWRHREAGAVPSAVTTTDQMAVYLPRKVDENPFDRLGHLFAECDIVLVEGYANG
FT                   PGANIEVWRAANGKDPLFPERDDILAVVTDDPVETGLPVWPRRDVAAIVDAMMRL"
     atgaaaatct ttcatatcgt gggccggtcc aaaaacggaa aaacaacgct tattttagag        60
     ctgatcgcgg aactcagaaa acggggcctg gccgtgggca ccctgaaaca cagcggccat       120
     gcccatgaac tggaaacacc gggcaaggac tcctggcggc atcgggaggc cggggccgtg       180
     ccgtccgccg taaccaccac cgaccagatg gcggtttacc tgccccgcaa ggtggatgaa       240
     aatccttttg accggctggg ccacctgttt gccgaatgcg acatcgtgct ggtggaaggg       300
     tatgcaaacg gcccgggcgc aaacattgag gtgtggcggg ccgccaatgg aaaggacccg       360
     ctgtttccgg aaagagacga catcctggcc gtggtcaccg acgacccggt tgaaaccggc       420
     ctgccggtat ggcccagacg cgacgtggcc gccattgtgg atgccatgat gcgcctgtag       480
//

If you have problems or comments...

PBIL Back to PBIL home page