(data stored in ACNUC7421 zone)

EMBL: CP000859.PE209

CP000859.PE209       Location/Qualifiers
FT   CDS_pept        231184..231960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0209"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nis:NIS_0019 molybdenum ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66019"
FT                   /db_xref="GOA:A8ZS01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS01"
FT                   /protein_id="ABW66019.1"
FT                   /translation="MNRVFDAIIWGTAGLLILAFIGLFAGMLVELGQEKVLSSPDLGRV
FT                   LFAVKLSLFTATIASVFALAVSVPVAYLFSRHTFFGKRFFDTLLDLPIVLSPIALGAML
FT                   LIFFNTPLGKQLNHYFGPFVFEVKGIILAQFFVVVGLSLRLLRATFEGIDEEYENLART
FT                   LGYSKMRTFFRVVLPMAGKGIISSFLLVWGRSIGEFGATVTLAGAMTMKTETIPVAIYL
FT                   SFESANITGALIYITLLVTMSLAILFFVRTLKVGTI"
     atgaatcgtg tttttgatgc catcatctgg ggaaccgcag ggcttcttat tcttgctttt        60
     atcggccttt tcgcgggcat gctggtcgaa ctgggacagg aaaaagttct ctcgtctccc       120
     gatttgggaa gagtcctttt tgcggtaaag ctttctcttt tcacggccac aatcgcctct       180
     gttttcgccc tggcagtttc cgtgcccgtg gcgtatctct tttccagaca tacctttttc       240
     ggtaaacggt tttttgatac cctgcttgat ttgccgatcg ttctgtctcc cattgccctt       300
     ggggccatgc tccttatctt ttttaatacg ccgttgggaa aacagcttaa ccattatttc       360
     ggcccttttg tttttgaggt gaagggaatt attctggccc agttttttgt ggtggtcggg       420
     ctgtccttgc gattgctgcg ggcgacgttt gaagggatcg acgaggaata tgaaaatctg       480
     gcccgaacac tggggtatag caaaatgcgg acgtttttcc gcgtggtgct gcccatggcc       540
     ggtaaaggta ttatctcttc ttttttgctg gtctggggaa ggtccatcgg ggagtttggc       600
     gccacggtga ccctggccgg cgccatgacc atgaagacgg aaaccattcc cgttgccatc       660
     tatttaagct ttgagtccgc caacattacg ggcgccctga tttatattac gcttctggtt       720
     accatgtcgc tggccattct tttttttgta agaacattaa aggtgggaac gatatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page