(data stored in ACNUC7421 zone)

EMBL: CP000859.PE21

CP000859.PE21        Location/Qualifiers
FT   CDS_pept        complement(22361..23017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0021"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: dps:DP0805 similar to
FT                   beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65831"
FT                   /db_xref="GOA:A8ZRR4"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRR4"
FT                   /protein_id="ABW65831.1"
FT                   /translation="MSDTTRQTVKIIAFDCDGVLFDTDDANRAYYNRILVNMGLPEMTD
FT                   AQFSYVQMHTVNDSLAFLCGADGLDRAQALRKGLGYGPFIRHMKKAPGLEDLLDRLYNR
FT                   VHTAIATNRSNTMNRVLAEHGLADRFEMVVTALDVMRPKPAPEQLLKILDRFGAAPSEM
FT                   IYIGDSELDERAATSAQVPFIAYNNPALKADFHAPDMRAVGTILDRFSLAGRTGE"
     ttgagcgaca cgacacggca gaccgttaaa atcatcgcct ttgactgcga cggagtcctg        60
     tttgacacgg atgacgccaa ccgggcctac tacaaccgca ttttggtcaa catggggctg       120
     ccggagatga ccgacgccca gtttagttat gtgcagatgc acacggtcaa cgactctctg       180
     gcttttctct gtggagcaga tggcctggac cgggcacaag cacttcgaaa aggattgggg       240
     tatggtccgt ttatccggca catgaaaaaa gcccccggcc tggaagacct gctggaccgg       300
     ctttacaaca gggtccatac cgccattgcc accaaccgct ccaacaccat gaaccgggtc       360
     ctggccgagc atggccttgc cgacaggttc gagatggtgg tcacggcctt ggacgtgatg       420
     cggccaaagc cggccccgga gcagctgtta aaaattctcg accgctttgg cgcggccccc       480
     tcagaaatga tttacatcgg tgactcggaa ctggatgaac gggccgcaac ctcggcccag       540
     gtgccgttta tcgcctacaa caacccggca ctgaaagccg attttcacgc ccctgacatg       600
     cgggccgtgg ggaccatcct ggaccggttt tccctggcag gccggaccgg ggaatag          657
//

If you have problems or comments...

PBIL Back to PBIL home page